Anti G3BP2 pAb (ATL-HPA018304 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018304-25

• 
• 

Protein Description: GTPase activating protein (SH3 domain) binding protein 2
Gene Name: G3BP2
Alternative Gene Name: KIAA0660
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029405: 97%, ENSRNOG00000002433: 97%
Entrez Gene ID: 9908
Uniprot ID: Q9UN86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVE
• Gene Sequence: HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVE
• Gene ID - Mouse: ENSMUSG00000029405
• Gene ID - Rat: ENSRNOG00000002433
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti G3BP2 pAb (ATL-HPA018304 w/enhanced validation) – 6 Found

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Katz, Elad; Sims, Andrew H; Sproul, Duncan; Caldwell, Helen; Dixon, Michael J; Meehan, Richard R; Harrison, David J. Targeting of Rac GTPases blocks the spread of intact human breast cancer. Oncotarget. 2012;3(6):608-19. 

Ying, Shan; Khaperskyy, Denys A. UV damage induces G3BP1-dependent stress granule formation that is not driven by mTOR inhibition-mediated translation arrest. Journal Of Cell Science. 2020;133(20) 

Attwood, Kathleen M; Robichaud, Aaron; Westhaver, Lauren P; Castle, Elizabeth L; Brandman, David M; Balgi, Aruna D; Roberge, Michel; Colp, Patricia; Croul, Sidney; Kim, Inhwa; McCormick, Craig; Corcoran, Jennifer A; Weeks, Adrienne. Raloxifene prevents stress granule dissolution, impairs translational control and promotes cell death during hypoxia in glioblastoma cells. Cell Death & Disease. 2020;11(11):989. 

Dominguez, Francisco; Shiliaev, Nikita; Lukash, Tetyana; Agback, Peter; Palchevska, Oksana; Gould, Joseph R; Meshram, Chetan D; Prevelige, Peter E; Green, Todd J; Agback, Tatiana; Frolova, Elena I; Frolov, Ilya. NAP1L1 and NAP1L4 Binding to Hypervariable Domain of Chikungunya Virus nsP3 Protein Is Bivalent and Requires Phosphorylation. Journal Of Virology. 2021;95(16):e0083621. 

Dolliver, Stacia M; Kleer, Mariel; Bui-Marinos, Maxwell P; Ying, Shan; Corcoran, Jennifer A; Khaperskyy, Denys A. Nsp1 proteins of human coronaviruses HCoV-OC43 and SARS-CoV2 inhibit stress granule formation. Plos Pathogens. 2022;18(12):e1011041.