Anti G3BP2 pAb (ATL-HPA018304 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018304-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: G3BP2
Alternative Gene Name: KIAA0660
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029405: 97%, ENSRNOG00000002433: 97%
Entrez Gene ID: 9908
Uniprot ID: Q9UN86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVE |
| Gene Sequence | HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVE |
| Gene ID - Mouse | ENSMUSG00000029405 |
| Gene ID - Rat | ENSRNOG00000002433 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti G3BP2 pAb (ATL-HPA018304 w/enhanced validation) | |
| Datasheet | Anti G3BP2 pAb (ATL-HPA018304 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti G3BP2 pAb (ATL-HPA018304 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti G3BP2 pAb (ATL-HPA018304 w/enhanced validation) | |
| Datasheet | Anti G3BP2 pAb (ATL-HPA018304 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti G3BP2 pAb (ATL-HPA018304 w/enhanced validation) |
| Citations for Anti G3BP2 pAb (ATL-HPA018304 w/enhanced validation) – 6 Found |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| Katz, Elad; Sims, Andrew H; Sproul, Duncan; Caldwell, Helen; Dixon, Michael J; Meehan, Richard R; Harrison, David J. Targeting of Rac GTPases blocks the spread of intact human breast cancer. Oncotarget. 2012;3(6):608-19. PubMed |
| Ying, Shan; Khaperskyy, Denys A. UV damage induces G3BP1-dependent stress granule formation that is not driven by mTOR inhibition-mediated translation arrest. Journal Of Cell Science. 2020;133(20) PubMed |
| Attwood, Kathleen M; Robichaud, Aaron; Westhaver, Lauren P; Castle, Elizabeth L; Brandman, David M; Balgi, Aruna D; Roberge, Michel; Colp, Patricia; Croul, Sidney; Kim, Inhwa; McCormick, Craig; Corcoran, Jennifer A; Weeks, Adrienne. Raloxifene prevents stress granule dissolution, impairs translational control and promotes cell death during hypoxia in glioblastoma cells. Cell Death & Disease. 2020;11(11):989. PubMed |
| Dominguez, Francisco; Shiliaev, Nikita; Lukash, Tetyana; Agback, Peter; Palchevska, Oksana; Gould, Joseph R; Meshram, Chetan D; Prevelige, Peter E; Green, Todd J; Agback, Tatiana; Frolova, Elena I; Frolov, Ilya. NAP1L1 and NAP1L4 Binding to Hypervariable Domain of Chikungunya Virus nsP3 Protein Is Bivalent and Requires Phosphorylation. Journal Of Virology. 2021;95(16):e0083621. PubMed |
| Dolliver, Stacia M; Kleer, Mariel; Bui-Marinos, Maxwell P; Ying, Shan; Corcoran, Jennifer A; Khaperskyy, Denys A. Nsp1 proteins of human coronaviruses HCoV-OC43 and SARS-CoV2 inhibit stress granule formation. Plos Pathogens. 2022;18(12):e1011041. PubMed |