Anti G2E3 pAb (ATL-HPA001601)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001601-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: G2E3
Alternative Gene Name: FLJ20333, KIAA1333, PHF7B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035293: 74%, ENSRNOG00000004232: 81%
Entrez Gene ID: 55632
Uniprot ID: Q7L622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNT |
Gene Sequence | IQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNT |
Gene ID - Mouse | ENSMUSG00000035293 |
Gene ID - Rat | ENSRNOG00000004232 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti G2E3 pAb (ATL-HPA001601) | |
Datasheet | Anti G2E3 pAb (ATL-HPA001601) Datasheet (External Link) |
Vendor Page | Anti G2E3 pAb (ATL-HPA001601) at Atlas Antibodies |
Documents & Links for Anti G2E3 pAb (ATL-HPA001601) | |
Datasheet | Anti G2E3 pAb (ATL-HPA001601) Datasheet (External Link) |
Vendor Page | Anti G2E3 pAb (ATL-HPA001601) |