Anti G2E3 pAb (ATL-HPA001601)

Atlas Antibodies

SKU:
ATL-HPA001601-25
  • Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells in seminiferus ducts.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G2/M-phase specific E3 ubiquitin protein ligase
Gene Name: G2E3
Alternative Gene Name: FLJ20333, KIAA1333, PHF7B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035293: 74%, ENSRNOG00000004232: 81%
Entrez Gene ID: 55632
Uniprot ID: Q7L622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNT
Gene Sequence IQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNT
Gene ID - Mouse ENSMUSG00000035293
Gene ID - Rat ENSRNOG00000004232
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti G2E3 pAb (ATL-HPA001601)
Datasheet Anti G2E3 pAb (ATL-HPA001601) Datasheet (External Link)
Vendor Page Anti G2E3 pAb (ATL-HPA001601) at Atlas Antibodies

Documents & Links for Anti G2E3 pAb (ATL-HPA001601)
Datasheet Anti G2E3 pAb (ATL-HPA001601) Datasheet (External Link)
Vendor Page Anti G2E3 pAb (ATL-HPA001601)