Anti FZD8 pAb (ATL-HPA045025 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045025-25

Protein Description: frizzled class receptor 8
Gene Name: FZD8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036904: 100%, ENSRNOG00000061031: 100%
Entrez Gene ID: 8325
Uniprot ID: Q9H461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
• Gene Sequence: GSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
• Gene ID - Mouse: ENSMUSG00000036904
• Gene ID - Rat: ENSRNOG00000061031
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FZD8 pAb (ATL-HPA045025 w/enhanced validation) – 2 Found

Bohn, Jennifer A; Van Etten, Jamie L; Schagat, Trista L; Bowman, Brittany M; McEachin, Richard C; Freddolino, Peter L; Goldstrohm, Aaron C. Identification of diverse target RNAs that are functionally regulated by human Pumilio proteins. Nucleic Acids Research. 2018;46(1):362-386. 

Yang, Qiwei; Wang, Ye; Pan, Xiuwu; Ye, Jianqing; Gan, Sishun; Qu, Fajun; Chen, Lu; Chu, Chuanmin; Gao, Yi; Cui, Xingang. Frizzled 8 promotes the cell proliferation and metastasis of renal cell carcinoma. Oncotarget. 2017;8(45):78989-79002.