Anti FZD8 pAb (ATL-HPA045025 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045025-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FZD8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036904: 100%, ENSRNOG00000061031: 100%
Entrez Gene ID: 8325
Uniprot ID: Q9H461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV |
| Gene Sequence | GSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV |
| Gene ID - Mouse | ENSMUSG00000036904 |
| Gene ID - Rat | ENSRNOG00000061031 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FZD8 pAb (ATL-HPA045025 w/enhanced validation) | |
| Datasheet | Anti FZD8 pAb (ATL-HPA045025 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FZD8 pAb (ATL-HPA045025 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FZD8 pAb (ATL-HPA045025 w/enhanced validation) | |
| Datasheet | Anti FZD8 pAb (ATL-HPA045025 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FZD8 pAb (ATL-HPA045025 w/enhanced validation) |
| Citations for Anti FZD8 pAb (ATL-HPA045025 w/enhanced validation) – 2 Found |
| Bohn, Jennifer A; Van Etten, Jamie L; Schagat, Trista L; Bowman, Brittany M; McEachin, Richard C; Freddolino, Peter L; Goldstrohm, Aaron C. Identification of diverse target RNAs that are functionally regulated by human Pumilio proteins. Nucleic Acids Research. 2018;46(1):362-386. PubMed |
| Yang, Qiwei; Wang, Ye; Pan, Xiuwu; Ye, Jianqing; Gan, Sishun; Qu, Fajun; Chen, Lu; Chu, Chuanmin; Gao, Yi; Cui, Xingang. Frizzled 8 promotes the cell proliferation and metastasis of renal cell carcinoma. Oncotarget. 2017;8(45):78989-79002. PubMed |