Anti FZD6 pAb (ATL-HPA017991 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017991-25

• 
• 
• 

Protein Description: frizzled class receptor 6
Gene Name: FZD6
Alternative Gene Name: Hfz6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107137: 55%, ENSRNOG00000004660: 62%
Entrez Gene ID: 8323
Uniprot ID: O60353
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVS
• Gene Sequence: TSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVS
• Gene ID - Mouse: ENSMUSG00000107137
• Gene ID - Rat: ENSRNOG00000004660
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FZD6 pAb (ATL-HPA017991 w/enhanced validation) – 2 Found

Chen, Zhenzhen; Gao, Yanfeng; Yao, Lintong; Liu, Yating; Huang, Lan; Yan, Zhongyi; Zhao, Wenshan; Zhu, Pingping; Weng, Haibo. LncFZD6 initiates Wnt/β-catenin and liver TIC self-renewal through BRG1-mediated FZD6 transcriptional activation. Oncogene. 2018;37(23):3098-3112. 

Strakova, Katerina; Kowalski-Jahn, Maria; Gybel, Tomas; Valnohova, Jana; Dhople, Vishnu M; Harnos, Jakub; Bernatik, Ondrej; Ganji, Ranjani Sri; Zdrahal, Zbynek; Mulder, Jan; Lindskog, Cecilia; Bryja, Vitezslav; Schulte, Gunnar. Dishevelled enables casein kinase 1-mediated phosphorylation of Frizzled 6 required for cell membrane localization. The Journal Of Biological Chemistry. 2018;293(48):18477-18493.