Anti FZD10 pAb (ATL-HPA014485)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014485-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FZD10
Alternative Gene Name: CD350
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000081683: 80%, ENSRNOG00000010227: 30%
Entrez Gene ID: 11211
Uniprot ID: Q9ULW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV |
Gene Sequence | KTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV |
Gene ID - Mouse | ENSMUSG00000081683 |
Gene ID - Rat | ENSRNOG00000010227 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FZD10 pAb (ATL-HPA014485) | |
Datasheet | Anti FZD10 pAb (ATL-HPA014485) Datasheet (External Link) |
Vendor Page | Anti FZD10 pAb (ATL-HPA014485) at Atlas Antibodies |
Documents & Links for Anti FZD10 pAb (ATL-HPA014485) | |
Datasheet | Anti FZD10 pAb (ATL-HPA014485) Datasheet (External Link) |
Vendor Page | Anti FZD10 pAb (ATL-HPA014485) |