Anti FZD10 pAb (ATL-HPA014485)

Atlas Antibodies

Catalog No.:
ATL-HPA014485-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: frizzled class receptor 10
Gene Name: FZD10
Alternative Gene Name: CD350
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000081683: 80%, ENSRNOG00000010227: 30%
Entrez Gene ID: 11211
Uniprot ID: Q9ULW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV
Gene Sequence KTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV
Gene ID - Mouse ENSMUSG00000081683
Gene ID - Rat ENSRNOG00000010227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FZD10 pAb (ATL-HPA014485)
Datasheet Anti FZD10 pAb (ATL-HPA014485) Datasheet (External Link)
Vendor Page Anti FZD10 pAb (ATL-HPA014485) at Atlas Antibodies

Documents & Links for Anti FZD10 pAb (ATL-HPA014485)
Datasheet Anti FZD10 pAb (ATL-HPA014485) Datasheet (External Link)
Vendor Page Anti FZD10 pAb (ATL-HPA014485)