Anti FZD10 pAb (ATL-HPA014484)

Atlas Antibodies

SKU:
ATL-HPA014484-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: frizzled class receptor 10
Gene Name: FZD10
Alternative Gene Name: CD350
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000081683: 85%, ENSRNOG00000047800: 32%
Entrez Gene ID: 11211
Uniprot ID: Q9ULW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERLNMDYWKILAAQHKCKMNNQTKTLDCLMAASI
Gene Sequence ERLNMDYWKILAAQHKCKMNNQTKTLDCLMAASI
Gene ID - Mouse ENSMUSG00000081683
Gene ID - Rat ENSRNOG00000047800
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FZD10 pAb (ATL-HPA014484)
Datasheet Anti FZD10 pAb (ATL-HPA014484) Datasheet (External Link)
Vendor Page Anti FZD10 pAb (ATL-HPA014484) at Atlas Antibodies

Documents & Links for Anti FZD10 pAb (ATL-HPA014484)
Datasheet Anti FZD10 pAb (ATL-HPA014484) Datasheet (External Link)
Vendor Page Anti FZD10 pAb (ATL-HPA014484)