Anti FXYD6 pAb (ATL-HPA041334 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041334-25

Protein Description: FXYD domain containing ion transport regulator 6
Gene Name: FXYD6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066705: 94%, ENSRNOG00000016412: 94%
Entrez Gene ID: 53826
Uniprot ID: Q9H0Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRRCKCSFNQKPRAPGDEEAQVENLITANATEP
• Gene Sequence: SRRCKCSFNQKPRAPGDEEAQVENLITANATEP
• Gene ID - Mouse: ENSMUSG00000066705
• Gene ID - Rat: ENSRNOG00000016412
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.