Anti FXYD6 pAb (ATL-HPA041334 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041334-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FXYD domain containing ion transport regulator 6
Gene Name: FXYD6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066705: 94%, ENSRNOG00000016412: 94%
Entrez Gene ID: 53826
Uniprot ID: Q9H0Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRRCKCSFNQKPRAPGDEEAQVENLITANATEP
Gene Sequence SRRCKCSFNQKPRAPGDEEAQVENLITANATEP
Gene ID - Mouse ENSMUSG00000066705
Gene ID - Rat ENSRNOG00000016412
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FXYD6 pAb (ATL-HPA041334 w/enhanced validation)
Datasheet Anti FXYD6 pAb (ATL-HPA041334 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FXYD6 pAb (ATL-HPA041334 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FXYD6 pAb (ATL-HPA041334 w/enhanced validation)
Datasheet Anti FXYD6 pAb (ATL-HPA041334 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FXYD6 pAb (ATL-HPA041334 w/enhanced validation)