Anti FXYD5 pAb (ATL-HPA010817 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010817-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FXYD5
Alternative Gene Name: OIT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009687: 33%, ENSRNOG00000021062: 31%
Entrez Gene ID: 53827
Uniprot ID: Q96DB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLR |
| Gene Sequence | DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLR |
| Gene ID - Mouse | ENSMUSG00000009687 |
| Gene ID - Rat | ENSRNOG00000021062 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FXYD5 pAb (ATL-HPA010817 w/enhanced validation) | |
| Datasheet | Anti FXYD5 pAb (ATL-HPA010817 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FXYD5 pAb (ATL-HPA010817 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FXYD5 pAb (ATL-HPA010817 w/enhanced validation) | |
| Datasheet | Anti FXYD5 pAb (ATL-HPA010817 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FXYD5 pAb (ATL-HPA010817 w/enhanced validation) |
| Citations for Anti FXYD5 pAb (ATL-HPA010817 w/enhanced validation) – 3 Found |
| Tokhtaeva, Elmira; Sun, Haying; Deiss-Yehiely, Nimrod; Wen, Yi; Soni, Pritin N; Gabrielli, Nieves M; Marcus, Elizabeth A; Ridge, Karen M; Sachs, George; Vazquez-Levin, Mónica; Sznajder, Jacob I; Vagin, Olga; Dada, Laura A. The O-glycosylated ectodomain of FXYD5 impairs adhesion by disrupting cell-cell trans-dimerization of Na,K-ATPase β1 subunits. Journal Of Cell Science. 2016;129(12):2394-406. PubMed |
| Brazee, Patricia L; Soni, Pritin N; Tokhtaeva, Elmira; Magnani, Natalia; Yemelyanov, Alex; Perlman, Harris R; Ridge, Karen M; Sznajder, Jacob I; Vagin, Olga; Dada, Laura A. FXYD5 Is an Essential Mediator of the Inflammatory Response during Lung Injury. Frontiers In Immunology. 8( 28620381):623. PubMed |
| Tassi, Renata A; Gambino, Angela; Ardighieri, Laura; Bignotti, Eliana; Todeschini, Paola; Romani, Chiara; Zanotti, Laura; Bugatti, Mattia; Borella, Fulvio; Katsaros, Dionyssios; Tognon, Germana; Sartori, Enrico; Odicino, Franco; Romualdi, Chiara; Ravaggi, Antonella. FXYD5 (Dysadherin) upregulation predicts shorter survival and reveals platinum resistance in high-grade serous ovarian cancer patients. British Journal Of Cancer. 2019;121(7):584-592. PubMed |