Anti FXYD3 pAb (ATL-HPA010856 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA010856-25

• 

Protein Description: FXYD domain containing ion transport regulator 3
Gene Name: FXYD3
Alternative Gene Name: MAT-8, PLML
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057092: 37%, ENSRNOG00000021095: 35%
Entrez Gene ID: 5349
Uniprot ID: Q14802
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS
• Gene Sequence: MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS
• Gene ID - Mouse: ENSMUSG00000057092
• Gene ID - Rat: ENSRNOG00000021095
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FXYD3 pAb (ATL-HPA010856 w/enhanced validation) – 2 Found

Okudela, Koji; Yazawa, Takuya; Ishii, Jun; Woo, Tetsukan; Mitsui, Hideaki; Bunai, Tomoyasu; Sakaeda, Masashi; Shimoyamada, Hiroaki; Sato, Hanako; Tajiri, Michihiko; Ogawa, Nobuo; Masuda, Munetaka; Sugimura, Haruhiko; Kitamura, Hitoshi. Down-regulation of FXYD3 expression in human lung cancers: its mechanism and potential role in carcinogenesis. The American Journal Of Pathology. 2009;175(6):2646-56. 

Cano Portillo, Camilo; Villacreses, Raul; Thurman, Andrew L; Pezzulo, Alejandro A; Zabner, Joseph; Thornell, Ian M. FXYD3 facilitates Na(+) and liquid absorption across human airway epithelia by increasing the transport capacity of the Na/K ATPase. American Journal Of Physiology. Cell Physiology. 2022;323(4):C1044-C1051.