Anti FXR1 pAb (ATL-HPA018246)

Atlas Antibodies

Catalog No.:
ATL-HPA018246-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: fragile X mental retardation, autosomal homolog 1
Gene Name: FXR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027680: 97%, ENSRNOG00000051480: 97%
Entrez Gene ID: 8087
Uniprot ID: P51114
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL
Gene Sequence TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL
Gene ID - Mouse ENSMUSG00000027680
Gene ID - Rat ENSRNOG00000051480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FXR1 pAb (ATL-HPA018246)
Datasheet Anti FXR1 pAb (ATL-HPA018246) Datasheet (External Link)
Vendor Page Anti FXR1 pAb (ATL-HPA018246) at Atlas Antibodies

Documents & Links for Anti FXR1 pAb (ATL-HPA018246)
Datasheet Anti FXR1 pAb (ATL-HPA018246) Datasheet (External Link)
Vendor Page Anti FXR1 pAb (ATL-HPA018246)
Citations for Anti FXR1 pAb (ATL-HPA018246) – 6 Found
Fan, Yichao; Yue, Jiao; Xiao, Mengtao; Han-Zhang, Han; Wang, Yao Vickie; Ma, Chun; Deng, Zhilin; Li, Yingxiang; Yu, Yanyan; Wang, Xinghao; Niu, Shen; Hua, Youjia; Weng, Zhiping; Atadja, Peter; Li, En; Xiang, Bin. FXR1 regulates transcription and is required for growth of human cancer cells with TP53/FXR2 homozygous deletion. Elife. 2017;6( 28767039)  PubMed
Agote-Arán, Arantxa; Lin, Junyan; Sumara, Izabela. Fragile X-Related Protein 1 Regulates Nucleoporin Localization in a Cell Cycle-Dependent Manner. Frontiers In Cell And Developmental Biology. 9( 34977012):755847.  PubMed
Fischer-Kešo, Regina; Breuninger, Sonja; Hofmann, Sarah; Henn, Manuela; Röhrig, Theresa; Ströbel, Philipp; Stoecklin, Georg; Hofmann, Ilse. Plakophilins 1 and 3 bind to FXR1 and thereby influence the mRNA stability of desmosomal proteins. Molecular And Cellular Biology. 2014;34(23):4244-56.  PubMed
Phelps, Hannah M; Pierce, Janene M; Murphy, Andrew J; Correa, Hernan; Qian, Jun; Massion, Pierre P; Lovvorn, Harold N 3rd. FXR1 expression domain in Wilms tumor. Journal Of Pediatric Surgery. 2019;54(6):1198-1205.  PubMed
Agote-Aran, Arantxa; Schmucker, Stephane; Jerabkova, Katerina; Jmel Boyer, Inès; Berto, Alessandro; Pacini, Laura; Ronchi, Paolo; Kleiss, Charlotte; Guerard, Laurent; Schwab, Yannick; Moine, Hervé; Mandel, Jean-Louis; Jacquemont, Sebastien; Bagni, Claudia; Sumara, Izabela. Spatial control of nucleoporin condensation by fragile X-related proteins. The Embo Journal. 2020;39(20):e104467.  PubMed
Nakanishi, Keita; Ozeki, Naoki; Tateyama, Hisashi; Kadomatsu, Yuka; Ueno, Harushi; Goto, Masaki; Nakamura, Shota; Fukumoto, Koichi; Chen-Yoshikawa, Toyofumi Fengshi. Skeletal muscle and related protein expression as prognostic factors in thymic squamous cell carcinoma. Journal Of Thoracic Disease. 2022;14(9):3245-3254.  PubMed