Anti FXR1 pAb (ATL-HPA018246)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018246-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: FXR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027680: 97%, ENSRNOG00000051480: 97%
Entrez Gene ID: 8087
Uniprot ID: P51114
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL |
Gene Sequence | TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL |
Gene ID - Mouse | ENSMUSG00000027680 |
Gene ID - Rat | ENSRNOG00000051480 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FXR1 pAb (ATL-HPA018246) | |
Datasheet | Anti FXR1 pAb (ATL-HPA018246) Datasheet (External Link) |
Vendor Page | Anti FXR1 pAb (ATL-HPA018246) at Atlas Antibodies |
Documents & Links for Anti FXR1 pAb (ATL-HPA018246) | |
Datasheet | Anti FXR1 pAb (ATL-HPA018246) Datasheet (External Link) |
Vendor Page | Anti FXR1 pAb (ATL-HPA018246) |
Citations for Anti FXR1 pAb (ATL-HPA018246) – 6 Found |
Fan, Yichao; Yue, Jiao; Xiao, Mengtao; Han-Zhang, Han; Wang, Yao Vickie; Ma, Chun; Deng, Zhilin; Li, Yingxiang; Yu, Yanyan; Wang, Xinghao; Niu, Shen; Hua, Youjia; Weng, Zhiping; Atadja, Peter; Li, En; Xiang, Bin. FXR1 regulates transcription and is required for growth of human cancer cells with TP53/FXR2 homozygous deletion. Elife. 2017;6( 28767039) PubMed |
Agote-Arán, Arantxa; Lin, Junyan; Sumara, Izabela. Fragile X-Related Protein 1 Regulates Nucleoporin Localization in a Cell Cycle-Dependent Manner. Frontiers In Cell And Developmental Biology. 9( 34977012):755847. PubMed |
Fischer-Kešo, Regina; Breuninger, Sonja; Hofmann, Sarah; Henn, Manuela; Röhrig, Theresa; Ströbel, Philipp; Stoecklin, Georg; Hofmann, Ilse. Plakophilins 1 and 3 bind to FXR1 and thereby influence the mRNA stability of desmosomal proteins. Molecular And Cellular Biology. 2014;34(23):4244-56. PubMed |
Phelps, Hannah M; Pierce, Janene M; Murphy, Andrew J; Correa, Hernan; Qian, Jun; Massion, Pierre P; Lovvorn, Harold N 3rd. FXR1 expression domain in Wilms tumor. Journal Of Pediatric Surgery. 2019;54(6):1198-1205. PubMed |
Agote-Aran, Arantxa; Schmucker, Stephane; Jerabkova, Katerina; Jmel Boyer, Inès; Berto, Alessandro; Pacini, Laura; Ronchi, Paolo; Kleiss, Charlotte; Guerard, Laurent; Schwab, Yannick; Moine, Hervé; Mandel, Jean-Louis; Jacquemont, Sebastien; Bagni, Claudia; Sumara, Izabela. Spatial control of nucleoporin condensation by fragile X-related proteins. The Embo Journal. 2020;39(20):e104467. PubMed |
Nakanishi, Keita; Ozeki, Naoki; Tateyama, Hisashi; Kadomatsu, Yuka; Ueno, Harushi; Goto, Masaki; Nakamura, Shota; Fukumoto, Koichi; Chen-Yoshikawa, Toyofumi Fengshi. Skeletal muscle and related protein expression as prognostic factors in thymic squamous cell carcinoma. Journal Of Thoracic Disease. 2022;14(9):3245-3254. PubMed |