Anti FUZ pAb (ATL-HPA042196)

Atlas Antibodies

SKU: ATL-HPA042196-25

• 
• 

Protein Description: fuzzy planar cell polarity protein
Gene Name: FUZ
Alternative Gene Name: FLJ22688, Fy
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011658: 89%, ENSRNOG00000053084: 88%
Entrez Gene ID: 80199
Uniprot ID: Q9BT04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDSELIGDLTQCVDCVIPPEGSLLQEALSGFAEAAGTTFVSLVVSGRVVAATEGWWRLGTPEAVLLPWLVGSLPPQTARDYPVYL
• Gene Sequence: GDSELIGDLTQCVDCVIPPEGSLLQEALSGFAEAAGTTFVSLVVSGRVVAATEGWWRLGTPEAVLLPWLVGSLPPQTARDYPVYL
• Gene ID - Mouse: ENSMUSG00000011658
• Gene ID - Rat: ENSRNOG00000053084
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.