Anti FUZ pAb (ATL-HPA041779 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041779-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FUZ
Alternative Gene Name: FLJ22688, Fy
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011658: 78%, ENSRNOG00000053084: 78%
Entrez Gene ID: 80199
Uniprot ID: Q9BT04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQLPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTP |
| Gene Sequence | LLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQLPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTP |
| Gene ID - Mouse | ENSMUSG00000011658 |
| Gene ID - Rat | ENSRNOG00000053084 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) | |
| Datasheet | Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) | |
| Datasheet | Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) |
| Citations for Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) – 1 Found |
| Sheng, Xin; Sheng, Yan; Liu, Yuehua; Li, Xiaoqiong; Shu, Bo; Li, Dayu. Effects of FSS on the expression and localization of the core proteins in two Wnt signaling pathways, and their association with ciliogenesis. International Journal Of Molecular Medicine. 2018;42(4):1809-1818. PubMed |