Anti FUZ pAb (ATL-HPA041779 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041779-25

• 
• 
• 

Protein Description: fuzzy planar cell polarity protein
Gene Name: FUZ
Alternative Gene Name: FLJ22688, Fy
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011658: 78%, ENSRNOG00000053084: 78%
Entrez Gene ID: 80199
Uniprot ID: Q9BT04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQLPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTP
• Gene Sequence: LLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQLPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTP
• Gene ID - Mouse: ENSMUSG00000011658
• Gene ID - Rat: ENSRNOG00000053084
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) – 1 Found

Sheng, Xin; Sheng, Yan; Liu, Yuehua; Li, Xiaoqiong; Shu, Bo; Li, Dayu. Effects of FSS on the expression and localization of the core proteins in two Wnt signaling pathways, and their association with ciliogenesis. International Journal Of Molecular Medicine. 2018;42(4):1809-1818.