Anti FUZ pAb (ATL-HPA041779 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041779-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fuzzy planar cell polarity protein
Gene Name: FUZ
Alternative Gene Name: FLJ22688, Fy
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011658: 78%, ENSRNOG00000053084: 78%
Entrez Gene ID: 80199
Uniprot ID: Q9BT04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQLPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTP
Gene Sequence LLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQLPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTP
Gene ID - Mouse ENSMUSG00000011658
Gene ID - Rat ENSRNOG00000053084
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FUZ pAb (ATL-HPA041779 w/enhanced validation)
Datasheet Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FUZ pAb (ATL-HPA041779 w/enhanced validation)
Datasheet Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FUZ pAb (ATL-HPA041779 w/enhanced validation)
Citations for Anti FUZ pAb (ATL-HPA041779 w/enhanced validation) – 1 Found
Sheng, Xin; Sheng, Yan; Liu, Yuehua; Li, Xiaoqiong; Shu, Bo; Li, Dayu. Effects of FSS on the expression and localization of the core proteins in two Wnt signaling pathways, and their association with ciliogenesis. International Journal Of Molecular Medicine. 2018;42(4):1809-1818.  PubMed