Anti FUT7 pAb (ATL-HPA042780)

Atlas Antibodies

Catalog No.:
ATL-HPA042780-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: fucosyltransferase 7 (alpha (1,3) fucosyltransferase)
Gene Name: FUT7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036587: 85%, ENSRNOG00000014156: 82%
Entrez Gene ID: 2529
Uniprot ID: Q11130
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
Gene Sequence PRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
Gene ID - Mouse ENSMUSG00000036587
Gene ID - Rat ENSRNOG00000014156
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FUT7 pAb (ATL-HPA042780)
Datasheet Anti FUT7 pAb (ATL-HPA042780) Datasheet (External Link)
Vendor Page Anti FUT7 pAb (ATL-HPA042780) at Atlas Antibodies

Documents & Links for Anti FUT7 pAb (ATL-HPA042780)
Datasheet Anti FUT7 pAb (ATL-HPA042780) Datasheet (External Link)
Vendor Page Anti FUT7 pAb (ATL-HPA042780)