Anti FUOM pAb (ATL-HPA039207)

Atlas Antibodies

SKU:
ATL-HPA039207-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: fucose mutarotase
Gene Name: FUOM
Alternative Gene Name: C10orf125, FLJ26016, FucM, FucU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025466: 87%, ENSRNOG00000047000: 86%
Entrez Gene ID: 282969
Uniprot ID: A2VDF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVL
Gene Sequence MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVL
Gene ID - Mouse ENSMUSG00000025466
Gene ID - Rat ENSRNOG00000047000
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FUOM pAb (ATL-HPA039207)
Datasheet Anti FUOM pAb (ATL-HPA039207) Datasheet (External Link)
Vendor Page Anti FUOM pAb (ATL-HPA039207) at Atlas Antibodies

Documents & Links for Anti FUOM pAb (ATL-HPA039207)
Datasheet Anti FUOM pAb (ATL-HPA039207) Datasheet (External Link)
Vendor Page Anti FUOM pAb (ATL-HPA039207)