Anti FUNDC1 pAb (ATL-HPA038773 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA038773-25
  • Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
  • Western blot analysis in human cell line HEK 293.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: FUN14 domain containing 1
Gene Name: FUNDC1
Alternative Gene Name: MGC51029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025040: 95%, ENSRNOG00000003470: 95%
Entrez Gene ID: 139341
Uniprot ID: Q8IVP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVM
Gene Sequence MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVM
Gene ID - Mouse ENSMUSG00000025040
Gene ID - Rat ENSRNOG00000003470
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FUNDC1 pAb (ATL-HPA038773 w/enhanced validation)
Datasheet Anti FUNDC1 pAb (ATL-HPA038773 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FUNDC1 pAb (ATL-HPA038773 w/enhanced validation)



Citations for Anti FUNDC1 pAb (ATL-HPA038773 w/enhanced validation) – 1 Found
Sugo, Masashi; Kimura, Hana; Arasaki, Kohei; Amemiya, Toshiki; Hirota, Naohiko; Dohmae, Naoshi; Imai, Yuzuru; Inoshita, Tsuyoshi; Shiba-Fukushima, Kahori; Hattori, Nobutaka; Cheng, Jinglei; Fujimoto, Toyoshi; Wakana, Yuichi; Inoue, Hiroki; Tagaya, Mitsuo. Syntaxin 17 regulates the localization and function of PGAM5 in mitochondrial division and mitophagy. The Embo Journal. 2018;37(21)  PubMed