Anti FUK pAb (ATL-HPA041971)

Atlas Antibodies

SKU:
ATL-HPA041971-25
  • Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line SiHa shows localization to vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: fucokinase
Gene Name: FUK
Alternative Gene Name: FLJ39408
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033703: 73%, ENSRNOG00000059453: 71%
Entrez Gene ID: 197258
Uniprot ID: Q8N0W3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HCMAENVTREDFLVGRPPELGQGDADVAGYLQSARAQLWRELRDQPLTMAYVSSGSYSYMTSSASEFLLSLTLPGAPGAQIVHSQV
Gene Sequence HCMAENVTREDFLVGRPPELGQGDADVAGYLQSARAQLWRELRDQPLTMAYVSSGSYSYMTSSASEFLLSLTLPGAPGAQIVHSQV
Gene ID - Mouse ENSMUSG00000033703
Gene ID - Rat ENSRNOG00000059453
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FUK pAb (ATL-HPA041971)
Datasheet Anti FUK pAb (ATL-HPA041971) Datasheet (External Link)
Vendor Page Anti FUK pAb (ATL-HPA041971) at Atlas Antibodies

Documents & Links for Anti FUK pAb (ATL-HPA041971)
Datasheet Anti FUK pAb (ATL-HPA041971) Datasheet (External Link)
Vendor Page Anti FUK pAb (ATL-HPA041971)