Anti FUCA2 pAb (ATL-HPA031659)

Atlas Antibodies

Catalog No.: ATL-HPA031659-25

Protein Description: fucosidase, alpha-L- 2, plasma
Gene Name: FUCA2
Alternative Gene Name: dJ20N2.5, MGC1314
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019810: 88%, ENSRNOG00000015551: 85%
Entrez Gene ID: 2519
Uniprot ID: Q9BTY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDG
• Gene Sequence: ELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDG
• Gene ID - Mouse: ENSMUSG00000019810
• Gene ID - Rat: ENSRNOG00000015551
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.