Anti FUCA2 pAb (ATL-HPA031659)

Atlas Antibodies

Catalog No.:
ATL-HPA031659-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: fucosidase, alpha-L- 2, plasma
Gene Name: FUCA2
Alternative Gene Name: dJ20N2.5, MGC1314
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019810: 88%, ENSRNOG00000015551: 85%
Entrez Gene ID: 2519
Uniprot ID: Q9BTY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDG
Gene Sequence ELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDG
Gene ID - Mouse ENSMUSG00000019810
Gene ID - Rat ENSRNOG00000015551
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FUCA2 pAb (ATL-HPA031659)
Datasheet Anti FUCA2 pAb (ATL-HPA031659) Datasheet (External Link)
Vendor Page Anti FUCA2 pAb (ATL-HPA031659) at Atlas Antibodies

Documents & Links for Anti FUCA2 pAb (ATL-HPA031659)
Datasheet Anti FUCA2 pAb (ATL-HPA031659) Datasheet (External Link)
Vendor Page Anti FUCA2 pAb (ATL-HPA031659)