Anti FTSJ1 pAb (ATL-HPA002718)

Atlas Antibodies

SKU:
ATL-HPA002718-25
  • Immunohistochemical staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes and extracellular positivity in blood vessels.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FtsJ RNA methyltransferase homolog 1 (E. coli)
Gene Name: FTSJ1
Alternative Gene Name: CDLIV, JM23, MRX44, MRX9, SPB1, TRM7, TRMT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031171: 73%, ENSRNOG00000004776: 73%
Entrez Gene ID: 24140
Uniprot ID: Q9UET6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
Gene Sequence FNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
Gene ID - Mouse ENSMUSG00000031171
Gene ID - Rat ENSRNOG00000004776
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FTSJ1 pAb (ATL-HPA002718)
Datasheet Anti FTSJ1 pAb (ATL-HPA002718) Datasheet (External Link)
Vendor Page Anti FTSJ1 pAb (ATL-HPA002718) at Atlas Antibodies

Documents & Links for Anti FTSJ1 pAb (ATL-HPA002718)
Datasheet Anti FTSJ1 pAb (ATL-HPA002718) Datasheet (External Link)
Vendor Page Anti FTSJ1 pAb (ATL-HPA002718)