Anti FTO pAb (ATL-HPA041086 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041086-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FTO
Alternative Gene Name: ALKBH9, KIAA1752, MGC5149
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055932: 79%, ENSRNOG00000011728: 79%
Entrez Gene ID: 79068
Uniprot ID: Q9C0B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP |
Gene Sequence | MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP |
Gene ID - Mouse | ENSMUSG00000055932 |
Gene ID - Rat | ENSRNOG00000011728 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FTO pAb (ATL-HPA041086 w/enhanced validation) | |
Datasheet | Anti FTO pAb (ATL-HPA041086 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FTO pAb (ATL-HPA041086 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FTO pAb (ATL-HPA041086 w/enhanced validation) | |
Datasheet | Anti FTO pAb (ATL-HPA041086 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FTO pAb (ATL-HPA041086 w/enhanced validation) |
Citations for Anti FTO pAb (ATL-HPA041086 w/enhanced validation) – 2 Found |
Zou, Dongling; Dong, Lei; Li, Chenying; Yin, Zhe; Rao, Shuan; Zhou, Qi. The m(6)A eraser FTO facilitates proliferation and migration of human cervical cancer cells. Cancer Cell International. 19( 31827395):321. PubMed |
Condic, Mateja; Thiesler, Thore; Staerk, Christian; Klümper, Niklas; Ellinger, Jörg; Egger, Eva K; Kübler, Kirsten; Kristiansen, Glen; Mustea, Alexander; Ralser, Damian J. N6-methyladenosine RNA modification (m6A) is of prognostic value in HPV-dependent vulvar squamous cell carcinoma. Bmc Cancer. 2022;22(1):943. PubMed |