Anti FTO pAb (ATL-HPA041086 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041086-25

Protein Description: fat mass and obesity associated
Gene Name: FTO
Alternative Gene Name: ALKBH9, KIAA1752, MGC5149
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055932: 79%, ENSRNOG00000011728: 79%
Entrez Gene ID: 79068
Uniprot ID: Q9C0B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP
• Gene Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP
• Gene ID - Mouse: ENSMUSG00000055932
• Gene ID - Rat: ENSRNOG00000011728
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FTO pAb (ATL-HPA041086 w/enhanced validation) – 2 Found

Zou, Dongling; Dong, Lei; Li, Chenying; Yin, Zhe; Rao, Shuan; Zhou, Qi. The m(6)A eraser FTO facilitates proliferation and migration of human cervical cancer cells. Cancer Cell International. 19( 31827395):321. 

Condic, Mateja; Thiesler, Thore; Staerk, Christian; Klümper, Niklas; Ellinger, Jörg; Egger, Eva K; Kübler, Kirsten; Kristiansen, Glen; Mustea, Alexander; Ralser, Damian J. N6-methyladenosine RNA modification (m6A) is of prognostic value in HPV-dependent vulvar squamous cell carcinoma. Bmc Cancer. 2022;22(1):943.