Anti FTL pAb (ATL-HPA041602 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041602-25

• 
• 
• 

Protein Description: ferritin, light polypeptide
Gene Name: FTL
Alternative Gene Name: MGC71996, NBIA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050708: 76%, ENSRNOG00000004662: 80%
Entrez Gene ID: 2512
Uniprot ID: P02792
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTD
• Gene Sequence: LFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTD
• Gene ID - Mouse: ENSMUSG00000050708
• Gene ID - Rat: ENSRNOG00000004662
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.