Anti FSTL4 pAb (ATL-HPA045920)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045920-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FSTL4
Alternative Gene Name: KIAA1061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036264: 70%, ENSRNOG00000006565: 65%
Entrez Gene ID: 23105
Uniprot ID: Q6MZW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGS |
| Gene Sequence | WMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGS |
| Gene ID - Mouse | ENSMUSG00000036264 |
| Gene ID - Rat | ENSRNOG00000006565 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FSTL4 pAb (ATL-HPA045920) | |
| Datasheet | Anti FSTL4 pAb (ATL-HPA045920) Datasheet (External Link) |
| Vendor Page | Anti FSTL4 pAb (ATL-HPA045920) at Atlas Antibodies |
| Documents & Links for Anti FSTL4 pAb (ATL-HPA045920) | |
| Datasheet | Anti FSTL4 pAb (ATL-HPA045920) Datasheet (External Link) |
| Vendor Page | Anti FSTL4 pAb (ATL-HPA045920) |