Anti FSTL4 pAb (ATL-HPA045920)
Atlas Antibodies
- SKU:
- ATL-HPA045920-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FSTL4
Alternative Gene Name: KIAA1061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036264: 70%, ENSRNOG00000006565: 65%
Entrez Gene ID: 23105
Uniprot ID: Q6MZW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGS |
Gene Sequence | WMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGS |
Gene ID - Mouse | ENSMUSG00000036264 |
Gene ID - Rat | ENSRNOG00000006565 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FSTL4 pAb (ATL-HPA045920) | |
Datasheet | Anti FSTL4 pAb (ATL-HPA045920) Datasheet (External Link) |
Vendor Page | Anti FSTL4 pAb (ATL-HPA045920) at Atlas Antibodies |
Documents & Links for Anti FSTL4 pAb (ATL-HPA045920) | |
Datasheet | Anti FSTL4 pAb (ATL-HPA045920) Datasheet (External Link) |
Vendor Page | Anti FSTL4 pAb (ATL-HPA045920) |