Anti FSTL4 pAb (ATL-HPA045920)

Atlas Antibodies

SKU:
ATL-HPA045920-25
  • Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells with distinct extracellular material.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: follistatin-like 4
Gene Name: FSTL4
Alternative Gene Name: KIAA1061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036264: 70%, ENSRNOG00000006565: 65%
Entrez Gene ID: 23105
Uniprot ID: Q6MZW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGS
Gene Sequence WMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGS
Gene ID - Mouse ENSMUSG00000036264
Gene ID - Rat ENSRNOG00000006565
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FSTL4 pAb (ATL-HPA045920)
Datasheet Anti FSTL4 pAb (ATL-HPA045920) Datasheet (External Link)
Vendor Page Anti FSTL4 pAb (ATL-HPA045920) at Atlas Antibodies

Documents & Links for Anti FSTL4 pAb (ATL-HPA045920)
Datasheet Anti FSTL4 pAb (ATL-HPA045920) Datasheet (External Link)
Vendor Page Anti FSTL4 pAb (ATL-HPA045920)