Anti FSTL3 pAb (ATL-HPA045378)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045378-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FSTL3
Alternative Gene Name: FLRG, FSRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020325: 84%, ENSRNOG00000009311: 85%
Entrez Gene ID: 10272
Uniprot ID: O95633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDG |
| Gene Sequence | MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDG |
| Gene ID - Mouse | ENSMUSG00000020325 |
| Gene ID - Rat | ENSRNOG00000009311 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FSTL3 pAb (ATL-HPA045378) | |
| Datasheet | Anti FSTL3 pAb (ATL-HPA045378) Datasheet (External Link) |
| Vendor Page | Anti FSTL3 pAb (ATL-HPA045378) at Atlas Antibodies |
| Documents & Links for Anti FSTL3 pAb (ATL-HPA045378) | |
| Datasheet | Anti FSTL3 pAb (ATL-HPA045378) Datasheet (External Link) |
| Vendor Page | Anti FSTL3 pAb (ATL-HPA045378) |