Anti FSD1L pAb (ATL-HPA035138)
Atlas Antibodies
- SKU:
- ATL-HPA035138-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FSD1L
Alternative Gene Name: CCDC10, CSDUFD1, FSD1CL, FSD1NL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054752: 92%, ENSRNOG00000059876: 95%
Entrez Gene ID: 83856
Uniprot ID: Q9BXM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA |
Gene Sequence | MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA |
Gene ID - Mouse | ENSMUSG00000054752 |
Gene ID - Rat | ENSRNOG00000059876 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FSD1L pAb (ATL-HPA035138) | |
Datasheet | Anti FSD1L pAb (ATL-HPA035138) Datasheet (External Link) |
Vendor Page | Anti FSD1L pAb (ATL-HPA035138) at Atlas Antibodies |
Documents & Links for Anti FSD1L pAb (ATL-HPA035138) | |
Datasheet | Anti FSD1L pAb (ATL-HPA035138) Datasheet (External Link) |
Vendor Page | Anti FSD1L pAb (ATL-HPA035138) |