Anti FSD1L pAb (ATL-HPA035138)

Atlas Antibodies

SKU: ATL-HPA035138-25

• 

Protein Description: fibronectin type III and SPRY domain containing 1-like
Gene Name: FSD1L
Alternative Gene Name: CCDC10, CSDUFD1, FSD1CL, FSD1NL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054752: 92%, ENSRNOG00000059876: 95%
Entrez Gene ID: 83856
Uniprot ID: Q9BXM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA
• Gene Sequence: MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA
• Gene ID - Mouse: ENSMUSG00000054752
• Gene ID - Rat: ENSRNOG00000059876
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.