Anti FSD1 pAb (ATL-HPA043141)

Atlas Antibodies

SKU: ATL-HPA043141-25

• 

Protein Description: fibronectin type III and SPRY domain containing 1
Gene Name: FSD1
Alternative Gene Name: MGC3213, MIR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011589: 93%, ENSRNOG00000050318: 92%
Entrez Gene ID: 79187
Uniprot ID: Q9BTV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDIKAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAE
• Gene Sequence: AVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDIKAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAE
• Gene ID - Mouse: ENSMUSG00000011589
• Gene ID - Rat: ENSRNOG00000050318
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.