Anti FSD1 pAb (ATL-HPA043141)

Atlas Antibodies

Catalog No.:
ATL-HPA043141-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: fibronectin type III and SPRY domain containing 1
Gene Name: FSD1
Alternative Gene Name: MGC3213, MIR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011589: 93%, ENSRNOG00000050318: 92%
Entrez Gene ID: 79187
Uniprot ID: Q9BTV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDIKAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAE
Gene Sequence AVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDIKAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAE
Gene ID - Mouse ENSMUSG00000011589
Gene ID - Rat ENSRNOG00000050318
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FSD1 pAb (ATL-HPA043141)
Datasheet Anti FSD1 pAb (ATL-HPA043141) Datasheet (External Link)
Vendor Page Anti FSD1 pAb (ATL-HPA043141) at Atlas Antibodies

Documents & Links for Anti FSD1 pAb (ATL-HPA043141)
Datasheet Anti FSD1 pAb (ATL-HPA043141) Datasheet (External Link)
Vendor Page Anti FSD1 pAb (ATL-HPA043141)