Anti FSBP pAb (ATL-HPA026509)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026509-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FSBP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094595: 83%, ENSRNOG00000015004: 81%
Entrez Gene ID: 100861412
Uniprot ID: O95073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SNISEPTKKVMEMIPQISSFCLVRDRNHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSP |
Gene Sequence | SNISEPTKKVMEMIPQISSFCLVRDRNHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSP |
Gene ID - Mouse | ENSMUSG00000094595 |
Gene ID - Rat | ENSRNOG00000015004 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FSBP pAb (ATL-HPA026509) | |
Datasheet | Anti FSBP pAb (ATL-HPA026509) Datasheet (External Link) |
Vendor Page | Anti FSBP pAb (ATL-HPA026509) at Atlas Antibodies |
Documents & Links for Anti FSBP pAb (ATL-HPA026509) | |
Datasheet | Anti FSBP pAb (ATL-HPA026509) Datasheet (External Link) |
Vendor Page | Anti FSBP pAb (ATL-HPA026509) |