Anti FSBP pAb (ATL-HPA026509)

Atlas Antibodies

Catalog No.:
ATL-HPA026509-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: fibrinogen silencer binding protein
Gene Name: FSBP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094595: 83%, ENSRNOG00000015004: 81%
Entrez Gene ID: 100861412
Uniprot ID: O95073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNISEPTKKVMEMIPQISSFCLVRDRNHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSP
Gene Sequence SNISEPTKKVMEMIPQISSFCLVRDRNHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSP
Gene ID - Mouse ENSMUSG00000094595
Gene ID - Rat ENSRNOG00000015004
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FSBP pAb (ATL-HPA026509)
Datasheet Anti FSBP pAb (ATL-HPA026509) Datasheet (External Link)
Vendor Page Anti FSBP pAb (ATL-HPA026509) at Atlas Antibodies

Documents & Links for Anti FSBP pAb (ATL-HPA026509)
Datasheet Anti FSBP pAb (ATL-HPA026509) Datasheet (External Link)
Vendor Page Anti FSBP pAb (ATL-HPA026509)