Anti FRYL pAb (ATL-HPA031107)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031107-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FRYL
Alternative Gene Name: DKFZp686E205, KIAA0826
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070733: 96%, ENSRNOG00000002248: 92%
Entrez Gene ID: 285527
Uniprot ID: O94915
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKA |
Gene Sequence | AYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKA |
Gene ID - Mouse | ENSMUSG00000070733 |
Gene ID - Rat | ENSRNOG00000002248 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FRYL pAb (ATL-HPA031107) | |
Datasheet | Anti FRYL pAb (ATL-HPA031107) Datasheet (External Link) |
Vendor Page | Anti FRYL pAb (ATL-HPA031107) at Atlas Antibodies |
Documents & Links for Anti FRYL pAb (ATL-HPA031107) | |
Datasheet | Anti FRYL pAb (ATL-HPA031107) Datasheet (External Link) |
Vendor Page | Anti FRYL pAb (ATL-HPA031107) |
Citations for Anti FRYL pAb (ATL-HPA031107) – 1 Found |
Byun, Yong-Sub; Kim, Eun-Kyoung; Araki, Kimi; Yamamura, Ken-Ichi; Lee, Kihoon; Yoon, Won-Kee; Won, Young-Suk; Kim, Hyoung-Chin; Choi, Kyung-Chul; Nam, Ki-Hoan. Fryl deficiency is associated with defective kidney development and function in mice. Experimental Biology And Medicine (Maywood, N.j.). 2018;243(5):408-417. PubMed |