Anti FRYL pAb (ATL-HPA031107)

Atlas Antibodies

Catalog No.:
ATL-HPA031107-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: FRY-like
Gene Name: FRYL
Alternative Gene Name: DKFZp686E205, KIAA0826
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070733: 96%, ENSRNOG00000002248: 92%
Entrez Gene ID: 285527
Uniprot ID: O94915
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKA
Gene Sequence AYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKA
Gene ID - Mouse ENSMUSG00000070733
Gene ID - Rat ENSRNOG00000002248
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FRYL pAb (ATL-HPA031107)
Datasheet Anti FRYL pAb (ATL-HPA031107) Datasheet (External Link)
Vendor Page Anti FRYL pAb (ATL-HPA031107) at Atlas Antibodies

Documents & Links for Anti FRYL pAb (ATL-HPA031107)
Datasheet Anti FRYL pAb (ATL-HPA031107) Datasheet (External Link)
Vendor Page Anti FRYL pAb (ATL-HPA031107)
Citations for Anti FRYL pAb (ATL-HPA031107) – 1 Found
Byun, Yong-Sub; Kim, Eun-Kyoung; Araki, Kimi; Yamamura, Ken-Ichi; Lee, Kihoon; Yoon, Won-Kee; Won, Young-Suk; Kim, Hyoung-Chin; Choi, Kyung-Chul; Nam, Ki-Hoan. Fryl deficiency is associated with defective kidney development and function in mice. Experimental Biology And Medicine (Maywood, N.j.). 2018;243(5):408-417.  PubMed