Anti FRYL pAb (ATL-HPA031106)

Atlas Antibodies

Catalog No.:
ATL-HPA031106-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: FRY-like
Gene Name: FRYL
Alternative Gene Name: DKFZp686E205, KIAA0826
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070733: 80%, ENSRNOG00000002248: 82%
Entrez Gene ID: 285527
Uniprot ID: O94915
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEMPEPLAPESYPESVC
Gene Sequence EEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEMPEPLAPESYPESVC
Gene ID - Mouse ENSMUSG00000070733
Gene ID - Rat ENSRNOG00000002248
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FRYL pAb (ATL-HPA031106)
Datasheet Anti FRYL pAb (ATL-HPA031106) Datasheet (External Link)
Vendor Page Anti FRYL pAb (ATL-HPA031106) at Atlas Antibodies

Documents & Links for Anti FRYL pAb (ATL-HPA031106)
Datasheet Anti FRYL pAb (ATL-HPA031106) Datasheet (External Link)
Vendor Page Anti FRYL pAb (ATL-HPA031106)