Anti FRRS1 pAb (ATL-HPA017883)

Atlas Antibodies

SKU:
ATL-HPA017883-25
  • Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ferric-chelate reductase 1
Gene Name: FRRS1
Alternative Gene Name: SDFR2, SDR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033386: 83%, ENSRNOG00000016351: 85%
Entrez Gene ID: 391059
Uniprot ID: Q6ZNA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHLTKPFSASDCGNKKFCIRSPLNCDPEKEASCVFLSFTRDDQSVMVEMSGPSKGYLSFALSHDQWMGDDDAYLCIHEDQTVYIQPSHLTGRSHPVMDSRDTLEDMAWRLADGVMQCSFRRNITLPGVKNRFDLNTSYYIFLADGAANDG
Gene Sequence SHLTKPFSASDCGNKKFCIRSPLNCDPEKEASCVFLSFTRDDQSVMVEMSGPSKGYLSFALSHDQWMGDDDAYLCIHEDQTVYIQPSHLTGRSHPVMDSRDTLEDMAWRLADGVMQCSFRRNITLPGVKNRFDLNTSYYIFLADGAANDG
Gene ID - Mouse ENSMUSG00000033386
Gene ID - Rat ENSRNOG00000016351
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FRRS1 pAb (ATL-HPA017883)
Datasheet Anti FRRS1 pAb (ATL-HPA017883) Datasheet (External Link)
Vendor Page Anti FRRS1 pAb (ATL-HPA017883) at Atlas Antibodies

Documents & Links for Anti FRRS1 pAb (ATL-HPA017883)
Datasheet Anti FRRS1 pAb (ATL-HPA017883) Datasheet (External Link)
Vendor Page Anti FRRS1 pAb (ATL-HPA017883)



Citations for Anti FRRS1 pAb (ATL-HPA017883) – 1 Found
Ji, Changyi; Kosman, Daniel J. Molecular mechanisms of non-transferrin-bound and transferring-bound iron uptake in primary hippocampal neurons. Journal Of Neurochemistry. 2015;133(5):668-83.  PubMed