Anti FRMPD1 pAb (ATL-HPA042934)

Atlas Antibodies

SKU: ATL-HPA042934-25

• 

Protein Description: FERM and PDZ domain containing 1
Gene Name: FRMPD1
Alternative Gene Name: FRMD2, KIAA0967
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035615: 88%, ENSRNOG00000012546: 85%
Entrez Gene ID: 22844
Uniprot ID: Q5SYB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRGGVKKYAKTLRKRRSFLQTDYTSQVSFPLVPSASLESVDDVCYYDREPYLALGAPSPTVSSLQDMQGEPGLLETKALGLLAPLRETKSTNPASRVMEMEPET
• Gene Sequence: RRGGVKKYAKTLRKRRSFLQTDYTSQVSFPLVPSASLESVDDVCYYDREPYLALGAPSPTVSSLQDMQGEPGLLETKALGLLAPLRETKSTNPASRVMEMEPET
• Gene ID - Mouse: ENSMUSG00000035615
• Gene ID - Rat: ENSRNOG00000012546
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FRMPD1 pAb (ATL-HPA042934) – 3 Found

Rong, Xuezhu; Han, Qiang; Lin, Xuyong; Kremerskothen, Joachim; Wang, Enhua. FRMPD1 activates the Hippo pathway via interaction with WWC3 to suppress the proliferation and invasiveness of lung cancer cells. Cancer Management And Research. 11( 31114375):3395-3410. 

Campla, Christie K; Mast, Hannah; Dong, Lijin; Lei, Jingqi; Halford, Stephanie; Sekaran, Sumathi; Swaroop, Anand. Targeted deletion of an NRL- and CRX-regulated alternative promoter specifically silences FERM and PDZ domain containing 1 (Frmpd1) in rod photoreceptors. Human Molecular Genetics. 2019;28(5):804-817. 

Campla, Christie K; Bocchero, Ulisse; Strickland, Ryan; Nellissery, Jacob; Advani, Jayshree; Ignatova, Irina; Srivastava, Dhiraj; Aponte, Angel M; Wang, Yuchen; Gumerson, Jessica; Martemyanov, Kirill; Artemyev, Nikolai O; Pahlberg, Johan; Swaroop, Anand. Frmpd1 Facilitates Trafficking of G-Protein Transducin and Modulates Synaptic Function in Rod Photoreceptors of Mammalian Retina. Eneuro. 2022;9(5)