Anti FRMD4A pAb (ATL-HPA038449)

Atlas Antibodies

SKU:
ATL-HPA038449-25
  • Immunohistochemical staining of human lymphoid tissues shows strong nuclear positivity in non-germinal center cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FERM domain containing 4A
Gene Name: FRMD4A
Alternative Gene Name: bA295P9.4, FLJ10210, FRMD4, KIAA1294
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026657: 97%, ENSRNOG00000018500: 96%
Entrez Gene ID: 55691
Uniprot ID: Q9P2Q2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGAHDKGAGRAAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSA
Gene Sequence EGAHDKGAGRAAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSA
Gene ID - Mouse ENSMUSG00000026657
Gene ID - Rat ENSRNOG00000018500
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FRMD4A pAb (ATL-HPA038449)
Datasheet Anti FRMD4A pAb (ATL-HPA038449) Datasheet (External Link)
Vendor Page Anti FRMD4A pAb (ATL-HPA038449) at Atlas Antibodies

Documents & Links for Anti FRMD4A pAb (ATL-HPA038449)
Datasheet Anti FRMD4A pAb (ATL-HPA038449) Datasheet (External Link)
Vendor Page Anti FRMD4A pAb (ATL-HPA038449)