Anti FRK pAb (ATL-HPA030479)

Atlas Antibodies

Catalog No.:
ATL-HPA030479-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: fyn related Src family tyrosine kinase
Gene Name: FRK
Alternative Gene Name: GTK, PTK5, RAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019779: 85%, ENSRNOG00000000543: 87%
Entrez Gene ID: 2444
Uniprot ID: P42685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQ
Gene Sequence RIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQ
Gene ID - Mouse ENSMUSG00000019779
Gene ID - Rat ENSRNOG00000000543
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FRK pAb (ATL-HPA030479)
Datasheet Anti FRK pAb (ATL-HPA030479) Datasheet (External Link)
Vendor Page Anti FRK pAb (ATL-HPA030479) at Atlas Antibodies

Documents & Links for Anti FRK pAb (ATL-HPA030479)
Datasheet Anti FRK pAb (ATL-HPA030479) Datasheet (External Link)
Vendor Page Anti FRK pAb (ATL-HPA030479)