Anti FRK pAb (ATL-HPA030479)

Atlas Antibodies

Catalog No.: ATL-HPA030479-25

Protein Description: fyn related Src family tyrosine kinase
Gene Name: FRK
Alternative Gene Name: GTK, PTK5, RAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019779: 85%, ENSRNOG00000000543: 87%
Entrez Gene ID: 2444
Uniprot ID: P42685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQ
• Gene Sequence: RIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQ
• Gene ID - Mouse: ENSMUSG00000019779
• Gene ID - Rat: ENSRNOG00000000543
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.