Anti FRA10AC1 pAb (ATL-HPA039204)

Atlas Antibodies

SKU: ATL-HPA039204-25

• 

Protein Description: fragile site, folic acid type, rare, fra(10)(q23.3) or fra(10)(q24.2) candidate 1
Gene Name: FRA10AC1
Alternative Gene Name: C10orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054237: 97%, ENSRNOG00000015235: 97%
Entrez Gene ID: 118924
Uniprot ID: Q70Z53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLDREEARNRRFHLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGENDKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENK
• Gene Sequence: LLDREEARNRRFHLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGENDKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENK
• Gene ID - Mouse: ENSMUSG00000054237
• Gene ID - Rat: ENSRNOG00000015235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.