Anti FRA10AC1 pAb (ATL-HPA039204)

Atlas Antibodies

Catalog No.:
ATL-HPA039204-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: fragile site, folic acid type, rare, fra(10)(q23.3) or fra(10)(q24.2) candidate 1
Gene Name: FRA10AC1
Alternative Gene Name: C10orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054237: 97%, ENSRNOG00000015235: 97%
Entrez Gene ID: 118924
Uniprot ID: Q70Z53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLDREEARNRRFHLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGENDKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENK
Gene Sequence LLDREEARNRRFHLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGENDKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENK
Gene ID - Mouse ENSMUSG00000054237
Gene ID - Rat ENSRNOG00000015235
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FRA10AC1 pAb (ATL-HPA039204)
Datasheet Anti FRA10AC1 pAb (ATL-HPA039204) Datasheet (External Link)
Vendor Page Anti FRA10AC1 pAb (ATL-HPA039204) at Atlas Antibodies

Documents & Links for Anti FRA10AC1 pAb (ATL-HPA039204)
Datasheet Anti FRA10AC1 pAb (ATL-HPA039204) Datasheet (External Link)
Vendor Page Anti FRA10AC1 pAb (ATL-HPA039204)