Anti FOXRED1 pAb (ATL-HPA046192)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046192-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FOXRED1
Alternative Gene Name: H17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039048: 79%, ENSRNOG00000060379: 80%
Entrez Gene ID: 55572
Uniprot ID: Q96CU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSVGGIRQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNK |
Gene Sequence | LSVGGIRQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNK |
Gene ID - Mouse | ENSMUSG00000039048 |
Gene ID - Rat | ENSRNOG00000060379 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FOXRED1 pAb (ATL-HPA046192) | |
Datasheet | Anti FOXRED1 pAb (ATL-HPA046192) Datasheet (External Link) |
Vendor Page | Anti FOXRED1 pAb (ATL-HPA046192) at Atlas Antibodies |
Documents & Links for Anti FOXRED1 pAb (ATL-HPA046192) | |
Datasheet | Anti FOXRED1 pAb (ATL-HPA046192) Datasheet (External Link) |
Vendor Page | Anti FOXRED1 pAb (ATL-HPA046192) |
Citations for Anti FOXRED1 pAb (ATL-HPA046192) – 1 Found |
Fei, Weiqiang; Liu, Shuiping; Hu, Xiaotong. High FOXRED1 expression predicted good prognosis of colorectal cancer. American Journal Of Cancer Research. 6(11):2722-2728. PubMed |