Anti FOXRED1 pAb (ATL-HPA039620)

Atlas Antibodies

Catalog No.:
ATL-HPA039620-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: FAD-dependent oxidoreductase domain containing 1
Gene Name: FOXRED1
Alternative Gene Name: H17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039048: 79%, ENSRNOG00000060379: 80%
Entrez Gene ID: 55572
Uniprot ID: Q96CU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSVGGIRQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNK
Gene Sequence LSVGGIRQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNK
Gene ID - Mouse ENSMUSG00000039048
Gene ID - Rat ENSRNOG00000060379
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXRED1 pAb (ATL-HPA039620)
Datasheet Anti FOXRED1 pAb (ATL-HPA039620) Datasheet (External Link)
Vendor Page Anti FOXRED1 pAb (ATL-HPA039620) at Atlas Antibodies

Documents & Links for Anti FOXRED1 pAb (ATL-HPA039620)
Datasheet Anti FOXRED1 pAb (ATL-HPA039620) Datasheet (External Link)
Vendor Page Anti FOXRED1 pAb (ATL-HPA039620)