Anti FOXO4 pAb (ATL-HPA039560)

Atlas Antibodies

Catalog No.:
ATL-HPA039560-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: forkhead box O4
Gene Name: FOXO4
Alternative Gene Name: AFX1, MLLT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042903: 87%, ENSRNOG00000033316: 85%
Entrez Gene ID: 4303
Uniprot ID: P98177
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG
Gene Sequence GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG
Gene ID - Mouse ENSMUSG00000042903
Gene ID - Rat ENSRNOG00000033316
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXO4 pAb (ATL-HPA039560)
Datasheet Anti FOXO4 pAb (ATL-HPA039560) Datasheet (External Link)
Vendor Page Anti FOXO4 pAb (ATL-HPA039560) at Atlas Antibodies

Documents & Links for Anti FOXO4 pAb (ATL-HPA039560)
Datasheet Anti FOXO4 pAb (ATL-HPA039560) Datasheet (External Link)
Vendor Page Anti FOXO4 pAb (ATL-HPA039560)