Anti FOXO4 pAb (ATL-HPA039560)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039560-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FOXO4
Alternative Gene Name: AFX1, MLLT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042903: 87%, ENSRNOG00000033316: 85%
Entrez Gene ID: 4303
Uniprot ID: P98177
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG |
| Gene Sequence | GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG |
| Gene ID - Mouse | ENSMUSG00000042903 |
| Gene ID - Rat | ENSRNOG00000033316 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOXO4 pAb (ATL-HPA039560) | |
| Datasheet | Anti FOXO4 pAb (ATL-HPA039560) Datasheet (External Link) |
| Vendor Page | Anti FOXO4 pAb (ATL-HPA039560) at Atlas Antibodies |
| Documents & Links for Anti FOXO4 pAb (ATL-HPA039560) | |
| Datasheet | Anti FOXO4 pAb (ATL-HPA039560) Datasheet (External Link) |
| Vendor Page | Anti FOXO4 pAb (ATL-HPA039560) |