Anti FOXM1 pAb (ATL-HPA029974)

Atlas Antibodies

Catalog No.:
ATL-HPA029974-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: forkhead box M1
Gene Name: FOXM1
Alternative Gene Name: FKHL16, HFH-11, HNF-3, INS-1, MPHOSPH2, MPP2, TGT3, trident
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001517: 73%, ENSRNOG00000005936: 75%
Entrez Gene ID: 2305
Uniprot ID: Q08050
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL
Gene Sequence GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL
Gene ID - Mouse ENSMUSG00000001517
Gene ID - Rat ENSRNOG00000005936
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXM1 pAb (ATL-HPA029974)
Datasheet Anti FOXM1 pAb (ATL-HPA029974) Datasheet (External Link)
Vendor Page Anti FOXM1 pAb (ATL-HPA029974) at Atlas Antibodies

Documents & Links for Anti FOXM1 pAb (ATL-HPA029974)
Datasheet Anti FOXM1 pAb (ATL-HPA029974) Datasheet (External Link)
Vendor Page Anti FOXM1 pAb (ATL-HPA029974)
Citations for Anti FOXM1 pAb (ATL-HPA029974) – 3 Found
Cohn, Ofir; Feldman, Michal; Weil, Lital; Kublanovsky, Margarita; Levy, Dan. Chromatin associated SETD3 negatively regulates VEGF expression. Scientific Reports. 2016;6( 27845446):37115.  PubMed
Tien, An-Chi; Li, Jing; Bao, Xun; Derogatis, Alanna; Kim, Seongho; Mehta, Shwetal; Sanai, Nader. A Phase 0 Trial of Ribociclib in Recurrent Glioblastoma Patients Incorporating a Tumor Pharmacodynamic- and Pharmacokinetic-Guided Expansion Cohort. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2019;25(19):5777-5786.  PubMed
Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Rönnerman, Elisabeth Werner; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Validation of Novel Prognostic Biomarkers for Early-Stage Clear-Cell, Endometrioid and Mucinous Ovarian Carcinomas Using Immunohistochemistry. Frontiers In Oncology. 10( 32133296):162.  PubMed