Anti FOXJ1 pAb (ATL-HPA005714 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA005714-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: forkhead box J1
Gene Name: FOXJ1
Alternative Gene Name: FKHL13, HFH-4, HFH4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034227: 91%, ENSRNOG00000036663: 29%
Entrez Gene ID: 2302
Uniprot ID: Q92949
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Gene Sequence PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Gene ID - Mouse ENSMUSG00000034227
Gene ID - Rat ENSRNOG00000036663
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXJ1 pAb (ATL-HPA005714 w/enhanced validation)
Datasheet Anti FOXJ1 pAb (ATL-HPA005714 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FOXJ1 pAb (ATL-HPA005714 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FOXJ1 pAb (ATL-HPA005714 w/enhanced validation)
Datasheet Anti FOXJ1 pAb (ATL-HPA005714 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FOXJ1 pAb (ATL-HPA005714 w/enhanced validation)
Citations for Anti FOXJ1 pAb (ATL-HPA005714 w/enhanced validation) – 12 Found
Abedalthagafi, Malak S; Wu, Michael P; Merrill, Parker H; Du, Ziming; Woo, Terri; Sheu, Shu-Hsien; Hurwitz, Shelley; Ligon, Keith L; Santagata, Sandro. Decreased FOXJ1 expression and its ciliogenesis programme in aggressive ependymoma and choroid plexus tumours. The Journal Of Pathology. 2016;238(4):584-97.  PubMed
Coy, Shannon; Du, Ziming; Sheu, Shu-Hsien; Woo, Terri; Rodriguez, Fausto J; Kieran, Mark W; Santagata, Sandro. Distinct patterns of primary and motile cilia in Rathke's cleft cysts and craniopharyngioma subtypes. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2016;29(12):1446-1459.  PubMed
Wang, Zhao; Plasschaert, Lindsey W; Aryal, Shivani; Renaud, Nicole A; Yang, Zinger; Choo-Wing, Rayman; Pessotti, Angelica D; Kirkpatrick, Nathaniel D; Cochran, Nadire R; Carbone, Walter; Maher, Rob; Lindeman, Alicia; Russ, Carsten; Reece-Hoyes, John; McAllister, Gregory; Hoffman, Gregory R; Roma, Guglielmo; Jaffe, Aron B. TRRAP is a central regulator of human multiciliated cell formation. The Journal Of Cell Biology. 2018;217(6):1941-1955.  PubMed
Plasschaert, Lindsey W; Žilionis, Rapolas; Choo-Wing, Rayman; Savova, Virginia; Knehr, Judith; Roma, Guglielmo; Klein, Allon M; Jaffe, Aron B. A single-cell atlas of the airway epithelium reveals the CFTR-rich pulmonary ionocyte. Nature. 2018;560(7718):377-381.  PubMed
Peng, Yang; Guan, Wei-Jie; Tan, Kai Sen; Zhu, Zhenchao; Chen, Zhuo; Hong, Haiyu; Wang, Zhaoni; Tian, Tengfei; Zi, Xiaoxue; Ong, Yew Kwang; Thong, Mark; Shi, Li; Yang, Qintai; Qiu, Qianhui; Wang, De-Yun. Aberrant localization of FOXJ1 correlates with the disease severity and comorbidities in patients with nasal polyps. Allergy, Asthma, And Clinical Immunology : Official Journal Of The Canadian Society Of Allergy And Clinical Immunology. 14( 30459817):71.  PubMed
Wallmeier, Julia; Bracht, Diana; Alsaif, Hessa S; Dougherty, Gerard W; Olbrich, Heike; Cindric, Sandra; Dzietko, Mark; Heyer, Christoph; Teig, Norbert; Thiels, Charlotte; Faqeih, Eissa; Al-Hashim, Aqeela; Khan, Sameena; Mogarri, Ibrahim; Almannai, Mohammed; Al Otaibi, Wadha; Alkuraya, Fowzan S; Koerner-Rettberg, Cordula; Omran, Heymut. Mutations in TP73 cause impaired mucociliary clearance and lissencephaly. American Journal Of Human Genetics. 2021;108(7):1318-1329.  PubMed
Song, Rui; Walentek, Peter; Sponer, Nicole; Klimke, Alexander; Lee, Joon Sub; Dixon, Gary; Harland, Richard; Wan, Ying; Lishko, Polina; Lize, Muriel; Kessel, Michael; He, Lin. miR-34/449 miRNAs are required for motile ciliogenesis by repressing cp110. Nature. 2014;510(7503):115-20.  PubMed
Chen, Qianmin; Tan, Kai Sen; Liu, Jing; Ong, Hsiao Hui; Zhou, Suizi; Huang, Hongming; Chen, Hailing; Ong, Yew Kwang; Thong, Mark; Chow, Vincent T; Qiu, Qianhui; Wang, De-Yun. Host Antiviral Response Suppresses Ciliogenesis and Motile Ciliary Functions in the Nasal Epithelium. Frontiers In Cell And Developmental Biology. 8( 33409274):581340.  PubMed
Omiya, Hanae; Yamaguchi, Shima; Watanabe, Tomoyuki; Kuniya, Takaaki; Harada, Yujin; Kawaguchi, Daichi; Gotoh, Yukiko. BMP signaling suppresses Gemc1 expression and ependymal differentiation of mouse telencephalic progenitors. Scientific Reports. 2021;11(1):613.  PubMed
Yang, Yue-Ying; Liu, Jing; Liu, Yi-Tong; Ong, Hsiao-Hui; Chen, Qian-Min; Chen, Ce-Belle; Thong, Mark; Xu, Xinni; Zhou, Sui-Zi; Qiu, Qian-Hui; Wang, De-Yun. Moderate Dose Irradiation Induces DNA Damage and Impairments of Barrier and Host Defense in Nasal Epithelial Cells in vitro. Journal Of Inflammation Research. 15( 35783248):3661-3675.  PubMed
Richardson, Michael T; Recouvreux, Maria Sol; Karlan, Beth Y; Walts, Ann E; Orsulic, Sandra. Ciliated Cells in Ovarian Cancer Decrease with Increasing Tumor Grade and Disease Progression. Cells. 2022;11(24)  PubMed
Ito, Sayaka; Yamaguchi, Yuna; Kubota, Sayaka; Yamamoto, Yuki; Kimura, Koji. Immunohistochemical identification of epithelial cell types in the isthmus of bovine oviduct: Comparison with the ampulla. The Journal Of Reproduction And Development. 2023;69(1):18-24.  PubMed