Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040670-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FOXC1
Alternative Gene Name: ARA, FKHL7, FREAC3, IGDA, IHG1, IRID1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050295: 98%, ENSRNOG00000017800: 98%
Entrez Gene ID: 2296
Uniprot ID: Q12948
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF |
| Gene Sequence | YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF |
| Gene ID - Mouse | ENSMUSG00000050295 |
| Gene ID - Rat | ENSRNOG00000017800 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation) | |
| Datasheet | Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation) | |
| Datasheet | Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation) |
| Citations for Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation) – 3 Found |
| Wang, Lu; Chai, Lulu; Ji, Qingchun; Cheng, Rongjie; Wang, Jiao; Han, Shiyu. Forkhead box protein C1 promotes cell proliferation and invasion in human cervical cancer. Molecular Medicine Reports. 2018;17(3):4392-4398. PubMed |
| Hirukawa, Alison; Smith, Harvey W; Zuo, Dongmei; Dufour, Catherine R; Savage, Paul; Bertos, Nicholas; Johnson, Radia M; Bui, Tung; Bourque, Guillaume; Basik, Mark; Giguère, Vincent; Park, Morag; Muller, William J. Targeting EZH2 reactivates a breast cancer subtype-specific anti-metastatic transcriptional program. Nature Communications. 2018;9(1):2547. PubMed |
| DeGraff, David J; Grabowska, Magdalena M; Case, Tom C; Yu, Xiuping; Herrick, Mary K; Hayward, William J; Strand, Douglas W; Cates, Justin M; Hayward, Simon W; Gao, Nan; Walter, Michael A; Buttyan, Ralph; Yi, Yajun; Kaestner, Klaus H; Matusik, Robert J. FOXA1 deletion in luminal epithelium causes prostatic hyperplasia and alteration of differentiated phenotype. Laboratory Investigation; A Journal Of Technical Methods And Pathology. 2014;94(7):726-39. PubMed |