Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040670-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: forkhead box C1
Gene Name: FOXC1
Alternative Gene Name: ARA, FKHL7, FREAC3, IGDA, IHG1, IRID1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050295: 98%, ENSRNOG00000017800: 98%
Entrez Gene ID: 2296
Uniprot ID: Q12948
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
Gene Sequence YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
Gene ID - Mouse ENSMUSG00000050295
Gene ID - Rat ENSRNOG00000017800
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation)
Datasheet Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation)
Datasheet Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation)
Citations for Anti FOXC1 pAb (ATL-HPA040670 w/enhanced validation) – 3 Found
Wang, Lu; Chai, Lulu; Ji, Qingchun; Cheng, Rongjie; Wang, Jiao; Han, Shiyu. Forkhead box protein C1 promotes cell proliferation and invasion in human cervical cancer. Molecular Medicine Reports. 2018;17(3):4392-4398.  PubMed
Hirukawa, Alison; Smith, Harvey W; Zuo, Dongmei; Dufour, Catherine R; Savage, Paul; Bertos, Nicholas; Johnson, Radia M; Bui, Tung; Bourque, Guillaume; Basik, Mark; Giguère, Vincent; Park, Morag; Muller, William J. Targeting EZH2 reactivates a breast cancer subtype-specific anti-metastatic transcriptional program. Nature Communications. 2018;9(1):2547.  PubMed
DeGraff, David J; Grabowska, Magdalena M; Case, Tom C; Yu, Xiuping; Herrick, Mary K; Hayward, William J; Strand, Douglas W; Cates, Justin M; Hayward, Simon W; Gao, Nan; Walter, Michael A; Buttyan, Ralph; Yi, Yajun; Kaestner, Klaus H; Matusik, Robert J. FOXA1 deletion in luminal epithelium causes prostatic hyperplasia and alteration of differentiated phenotype. Laboratory Investigation; A Journal Of Technical Methods And Pathology. 2014;94(7):726-39.  PubMed