Anti FOS pAb (ATL-HPA018531)

Atlas Antibodies

Catalog No.:
ATL-HPA018531-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: FBJ murine osteosarcoma viral oncogene homolog
Gene Name: FOS
Alternative Gene Name: AP-1, c-fos
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021250: 94%, ENSRNOG00000008015: 94%
Entrez Gene ID: 2353
Uniprot ID: P01100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL
Gene Sequence DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL
Gene ID - Mouse ENSMUSG00000021250
Gene ID - Rat ENSRNOG00000008015
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOS pAb (ATL-HPA018531)
Datasheet Anti FOS pAb (ATL-HPA018531) Datasheet (External Link)
Vendor Page Anti FOS pAb (ATL-HPA018531) at Atlas Antibodies

Documents & Links for Anti FOS pAb (ATL-HPA018531)
Datasheet Anti FOS pAb (ATL-HPA018531) Datasheet (External Link)
Vendor Page Anti FOS pAb (ATL-HPA018531)
Citations for Anti FOS pAb (ATL-HPA018531) – 5 Found
Diaferia, Giuseppe R; Balestrieri, Chiara; Prosperini, Elena; Nicoli, Paola; Spaggiari, Paola; Zerbi, Alessandro; Natoli, Gioacchino. Dissection of transcriptional and cis-regulatory control of differentiation in human pancreatic cancer. The Embo Journal. 2016;35(6):595-617.  PubMed
Pio, Rebecca; Jia, Zhenyu; Baron, Veronique T; Mercola, Dan. Early growth response 3 (Egr3) is highly over-expressed in non-relapsing prostate cancer but not in relapsing prostate cancer. Plos One. 8(1):e54096.  PubMed
Qi, Chu-Chu; Wang, Qing-Jun; Ma, Xue-Zhu; Chen, Hai-Chao; Gao, Li-Ping; Yin, Jie; Jing, Yu-Hong. Interaction of basolateral amygdala, ventral hippocampus and medial prefrontal cortex regulates the consolidation and extinction of social fear. Behavioral And Brain Functions : Bbf. 2018;14(1):7.  PubMed
Milan, Marta; Balestrieri, Chiara; Alfarano, Gabriele; Polletti, Sara; Prosperini, Elena; Spaggiari, Paola; Zerbi, Alessandro; Diaferia, Giuseppe R; Natoli, Gioacchino. FOXA2 controls the cis-regulatory networks of pancreatic cancer cells in a differentiation grade-specific manner. The Embo Journal. 2019;38(20):e102161.  PubMed
Guo, Hongshan; Golczer, Gabriel; Wittner, Ben S; Langenbucher, Adam; Zachariah, Marcus; Dubash, Taronish D; Hong, Xin; Comaills, Valentine; Burr, Risa; Ebright, Richard Y; Horwitz, Elad; Vuille, Joanna A; Hajizadeh, Soroush; Wiley, Devon F; Reeves, Brittany A; Zhang, Jia-Min; Niederhoffer, Kira L; Lu, Chenyue; Wesley, Benjamin; Ho, Uyen; Nieman, Linda T; Toner, Mehmet; Vasudevan, Shobha; Zou, Lee; Mostoslavsky, Raul; Maheswaran, Shyamala; Lawrence, Michael S; Haber, Daniel A. NR4A1 regulates expression of immediate early genes, suppressing replication stress in cancer. Molecular Cell. 2021;81(19):4041-4058.e15.  PubMed