Anti FOS pAb (ATL-HPA018531)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018531-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: FOS
Alternative Gene Name: AP-1, c-fos
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021250: 94%, ENSRNOG00000008015: 94%
Entrez Gene ID: 2353
Uniprot ID: P01100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL |
Gene Sequence | DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL |
Gene ID - Mouse | ENSMUSG00000021250 |
Gene ID - Rat | ENSRNOG00000008015 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FOS pAb (ATL-HPA018531) | |
Datasheet | Anti FOS pAb (ATL-HPA018531) Datasheet (External Link) |
Vendor Page | Anti FOS pAb (ATL-HPA018531) at Atlas Antibodies |
Documents & Links for Anti FOS pAb (ATL-HPA018531) | |
Datasheet | Anti FOS pAb (ATL-HPA018531) Datasheet (External Link) |
Vendor Page | Anti FOS pAb (ATL-HPA018531) |
Citations for Anti FOS pAb (ATL-HPA018531) – 5 Found |
Diaferia, Giuseppe R; Balestrieri, Chiara; Prosperini, Elena; Nicoli, Paola; Spaggiari, Paola; Zerbi, Alessandro; Natoli, Gioacchino. Dissection of transcriptional and cis-regulatory control of differentiation in human pancreatic cancer. The Embo Journal. 2016;35(6):595-617. PubMed |
Pio, Rebecca; Jia, Zhenyu; Baron, Veronique T; Mercola, Dan. Early growth response 3 (Egr3) is highly over-expressed in non-relapsing prostate cancer but not in relapsing prostate cancer. Plos One. 8(1):e54096. PubMed |
Qi, Chu-Chu; Wang, Qing-Jun; Ma, Xue-Zhu; Chen, Hai-Chao; Gao, Li-Ping; Yin, Jie; Jing, Yu-Hong. Interaction of basolateral amygdala, ventral hippocampus and medial prefrontal cortex regulates the consolidation and extinction of social fear. Behavioral And Brain Functions : Bbf. 2018;14(1):7. PubMed |
Milan, Marta; Balestrieri, Chiara; Alfarano, Gabriele; Polletti, Sara; Prosperini, Elena; Spaggiari, Paola; Zerbi, Alessandro; Diaferia, Giuseppe R; Natoli, Gioacchino. FOXA2 controls the cis-regulatory networks of pancreatic cancer cells in a differentiation grade-specific manner. The Embo Journal. 2019;38(20):e102161. PubMed |
Guo, Hongshan; Golczer, Gabriel; Wittner, Ben S; Langenbucher, Adam; Zachariah, Marcus; Dubash, Taronish D; Hong, Xin; Comaills, Valentine; Burr, Risa; Ebright, Richard Y; Horwitz, Elad; Vuille, Joanna A; Hajizadeh, Soroush; Wiley, Devon F; Reeves, Brittany A; Zhang, Jia-Min; Niederhoffer, Kira L; Lu, Chenyue; Wesley, Benjamin; Ho, Uyen; Nieman, Linda T; Toner, Mehmet; Vasudevan, Shobha; Zou, Lee; Mostoslavsky, Raul; Maheswaran, Shyamala; Lawrence, Michael S; Haber, Daniel A. NR4A1 regulates expression of immediate early genes, suppressing replication stress in cancer. Molecular Cell. 2021;81(19):4041-4058.e15. PubMed |