Anti FOPNL pAb (ATL-HPA040599 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040599-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FOPNL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408241).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FGFR1OP N-terminal like
Gene Name: FOPNL
Alternative Gene Name: C16orf63, DKFZp686N1651, FLJ31153, FOR20, PHSECRG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022677: 58%, ENSRNOG00000053230: 58%
Entrez Gene ID: 123811
Uniprot ID: Q96NB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQ
Gene Sequence IHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQ
Gene ID - Mouse ENSMUSG00000022677
Gene ID - Rat ENSRNOG00000053230
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FOPNL pAb (ATL-HPA040599 w/enhanced validation)
Datasheet Anti FOPNL pAb (ATL-HPA040599 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FOPNL pAb (ATL-HPA040599 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FOPNL pAb (ATL-HPA040599 w/enhanced validation)
Datasheet Anti FOPNL pAb (ATL-HPA040599 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FOPNL pAb (ATL-HPA040599 w/enhanced validation)