Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA010593-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: folate hydrolase (prostate-specific membrane antigen) 1
Gene Name: FOLH1
Alternative Gene Name: FOLH, GCP2, GCPII, NAALAD1, NAALAdase, PSM, PSMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001773: 86%, ENSRNOG00000013770: 90%
Entrez Gene ID: 2346
Uniprot ID: Q04609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF
Gene Sequence ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF
Gene ID - Mouse ENSMUSG00000001773
Gene ID - Rat ENSRNOG00000013770
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation)
Datasheet Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation)
Datasheet Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation)
Citations for Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) – 2 Found
Jaraj, Sara Jonmarker; Augsten, Martin; Häggarth, Lars; Wester, Kenneth; Pontén, Fredrik; Ostman, Arne; Egevad, Lars. GAD1 is a biomarker for benign and malignant prostatic tissue. Scandinavian Journal Of Urology And Nephrology. 2011;45(1):39-45.  PubMed
Hudson, Elton P; Uhlen, Mathias; Rockberg, Johan. Multiplex epitope mapping using bacterial surface display reveals both linear and conformational epitopes. Scientific Reports. 2( 23050090):706.  PubMed