Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA010593-25

• 

Protein Description: folate hydrolase (prostate-specific membrane antigen) 1
Gene Name: FOLH1
Alternative Gene Name: FOLH, GCP2, GCPII, NAALAD1, NAALAdase, PSM, PSMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001773: 86%, ENSRNOG00000013770: 90%
Entrez Gene ID: 2346
Uniprot ID: Q04609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF
• Gene Sequence: ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF
• Gene ID - Mouse: ENSMUSG00000001773
• Gene ID - Rat: ENSRNOG00000013770
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) – 2 Found

Jaraj, Sara Jonmarker; Augsten, Martin; Häggarth, Lars; Wester, Kenneth; Pontén, Fredrik; Ostman, Arne; Egevad, Lars. GAD1 is a biomarker for benign and malignant prostatic tissue. Scandinavian Journal Of Urology And Nephrology. 2011;45(1):39-45. 

Hudson, Elton P; Uhlen, Mathias; Rockberg, Johan. Multiplex epitope mapping using bacterial surface display reveals both linear and conformational epitopes. Scientific Reports. 2( 23050090):706.