Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA010593-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FOLH1
Alternative Gene Name: FOLH, GCP2, GCPII, NAALAD1, NAALAdase, PSM, PSMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001773: 86%, ENSRNOG00000013770: 90%
Entrez Gene ID: 2346
Uniprot ID: Q04609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF |
Gene Sequence | ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF |
Gene ID - Mouse | ENSMUSG00000001773 |
Gene ID - Rat | ENSRNOG00000013770 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) | |
Datasheet | Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) | |
Datasheet | Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) |
Citations for Anti FOLH1 pAb (ATL-HPA010593 w/enhanced validation) – 2 Found |
Jaraj, Sara Jonmarker; Augsten, Martin; Häggarth, Lars; Wester, Kenneth; Pontén, Fredrik; Ostman, Arne; Egevad, Lars. GAD1 is a biomarker for benign and malignant prostatic tissue. Scandinavian Journal Of Urology And Nephrology. 2011;45(1):39-45. PubMed |
Hudson, Elton P; Uhlen, Mathias; Rockberg, Johan. Multiplex epitope mapping using bacterial surface display reveals both linear and conformational epitopes. Scientific Reports. 2( 23050090):706. PubMed |