Anti FNIP2 pAb (ATL-HPA042779)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042779-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FNIP2
Alternative Gene Name: FNIPL, KIAA1450, MAPO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061175: 52%, ENSRNOG00000027833: 55%
Entrez Gene ID: 57600
Uniprot ID: Q9P278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDQQAVCELLKVEMPTRLPDRSVAWPCPDRHLREKPSLEKVTFQIGSFASPESDFESRMKKMEERVKACGPSLEASEAADVAQDPQVSRSP |
Gene Sequence | MDQQAVCELLKVEMPTRLPDRSVAWPCPDRHLREKPSLEKVTFQIGSFASPESDFESRMKKMEERVKACGPSLEASEAADVAQDPQVSRSP |
Gene ID - Mouse | ENSMUSG00000061175 |
Gene ID - Rat | ENSRNOG00000027833 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FNIP2 pAb (ATL-HPA042779) | |
Datasheet | Anti FNIP2 pAb (ATL-HPA042779) Datasheet (External Link) |
Vendor Page | Anti FNIP2 pAb (ATL-HPA042779) at Atlas Antibodies |
Documents & Links for Anti FNIP2 pAb (ATL-HPA042779) | |
Datasheet | Anti FNIP2 pAb (ATL-HPA042779) Datasheet (External Link) |
Vendor Page | Anti FNIP2 pAb (ATL-HPA042779) |
Citations for Anti FNIP2 pAb (ATL-HPA042779) – 2 Found |
Nagashima, Katsuyuki; Fukushima, Hidefumi; Shimizu, Kouhei; Yamada, Aya; Hidaka, Masumi; Hasumi, Hisashi; Ikebe, Tetsuro; Fukumoto, Satoshi; Okabe, Koji; Inuzuka, Hiroyuki. Nutrient-induced FNIP degradation by SCFβ-TRCP regulates FLCN complex localization and promotes renal cancer progression. Oncotarget. 2017;8(6):9947-9960. PubMed |
Glykofridis, Iris E; Knol, Jaco C; Balk, Jesper A; Westland, Denise; Pham, Thang V; Piersma, Sander R; Lougheed, Sinéad M; Derakhshan, Sepide; Veen, Puck; Rooimans, Martin A; van Mil, Saskia E; Böttger, Franziska; Poddighe, Pino J; van de Beek, Irma; Drost, Jarno; Zwartkruis, Fried Jt; de Menezes, Renee X; Meijers-Heijboer, Hanne Ej; Houweling, Arjan C; Jimenez, Connie R; Wolthuis, Rob Mf. Loss of FLCN-FNIP1/2 induces a non-canonical interferon response in human renal tubular epithelial cells. Elife. 2021;10( 33459596) PubMed |