Anti FNIP2 pAb (ATL-HPA042779)

Atlas Antibodies

Catalog No.:
ATL-HPA042779-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: folliculin interacting protein 2
Gene Name: FNIP2
Alternative Gene Name: FNIPL, KIAA1450, MAPO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061175: 52%, ENSRNOG00000027833: 55%
Entrez Gene ID: 57600
Uniprot ID: Q9P278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDQQAVCELLKVEMPTRLPDRSVAWPCPDRHLREKPSLEKVTFQIGSFASPESDFESRMKKMEERVKACGPSLEASEAADVAQDPQVSRSP
Gene Sequence MDQQAVCELLKVEMPTRLPDRSVAWPCPDRHLREKPSLEKVTFQIGSFASPESDFESRMKKMEERVKACGPSLEASEAADVAQDPQVSRSP
Gene ID - Mouse ENSMUSG00000061175
Gene ID - Rat ENSRNOG00000027833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FNIP2 pAb (ATL-HPA042779)
Datasheet Anti FNIP2 pAb (ATL-HPA042779) Datasheet (External Link)
Vendor Page Anti FNIP2 pAb (ATL-HPA042779) at Atlas Antibodies

Documents & Links for Anti FNIP2 pAb (ATL-HPA042779)
Datasheet Anti FNIP2 pAb (ATL-HPA042779) Datasheet (External Link)
Vendor Page Anti FNIP2 pAb (ATL-HPA042779)
Citations for Anti FNIP2 pAb (ATL-HPA042779) – 2 Found
Nagashima, Katsuyuki; Fukushima, Hidefumi; Shimizu, Kouhei; Yamada, Aya; Hidaka, Masumi; Hasumi, Hisashi; Ikebe, Tetsuro; Fukumoto, Satoshi; Okabe, Koji; Inuzuka, Hiroyuki. Nutrient-induced FNIP degradation by SCFβ-TRCP regulates FLCN complex localization and promotes renal cancer progression. Oncotarget. 2017;8(6):9947-9960.  PubMed
Glykofridis, Iris E; Knol, Jaco C; Balk, Jesper A; Westland, Denise; Pham, Thang V; Piersma, Sander R; Lougheed, Sinéad M; Derakhshan, Sepide; Veen, Puck; Rooimans, Martin A; van Mil, Saskia E; Böttger, Franziska; Poddighe, Pino J; van de Beek, Irma; Drost, Jarno; Zwartkruis, Fried Jt; de Menezes, Renee X; Meijers-Heijboer, Hanne Ej; Houweling, Arjan C; Jimenez, Connie R; Wolthuis, Rob Mf. Loss of FLCN-FNIP1/2 induces a non-canonical interferon response in human renal tubular epithelial cells. Elife. 2021;10( 33459596)  PubMed