Anti FNDC9 pAb (ATL-HPA017291)

Atlas Antibodies

SKU:
ATL-HPA017291-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fibronectin type III domain containing 9
Gene Name: FNDC9
Alternative Gene Name: C5orf40, MGC27121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048721: 91%, ENSRNOG00000006549: 91%
Entrez Gene ID: 408263
Uniprot ID: Q8TBE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHHEEKVPRTISSVVLEHLAPSTLYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSSLV
Gene Sequence VGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHHEEKVPRTISSVVLEHLAPSTLYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSSLV
Gene ID - Mouse ENSMUSG00000048721
Gene ID - Rat ENSRNOG00000006549
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FNDC9 pAb (ATL-HPA017291)
Datasheet Anti FNDC9 pAb (ATL-HPA017291) Datasheet (External Link)
Vendor Page Anti FNDC9 pAb (ATL-HPA017291) at Atlas Antibodies

Documents & Links for Anti FNDC9 pAb (ATL-HPA017291)
Datasheet Anti FNDC9 pAb (ATL-HPA017291) Datasheet (External Link)
Vendor Page Anti FNDC9 pAb (ATL-HPA017291)