Anti FNDC3B pAb (ATL-HPA007859)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007859-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FNDC3B
Alternative Gene Name: DKFZp762K137, FAD104, FLJ23399, PRO4979, YVTM2421
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039286: 92%, ENSRNOG00000024089: 94%
Entrez Gene ID: 64778
Uniprot ID: Q53EP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTYITREDQYSK |
Gene Sequence | SIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTYITREDQYSK |
Gene ID - Mouse | ENSMUSG00000039286 |
Gene ID - Rat | ENSRNOG00000024089 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FNDC3B pAb (ATL-HPA007859) | |
Datasheet | Anti FNDC3B pAb (ATL-HPA007859) Datasheet (External Link) |
Vendor Page | Anti FNDC3B pAb (ATL-HPA007859) at Atlas Antibodies |
Documents & Links for Anti FNDC3B pAb (ATL-HPA007859) | |
Datasheet | Anti FNDC3B pAb (ATL-HPA007859) Datasheet (External Link) |
Vendor Page | Anti FNDC3B pAb (ATL-HPA007859) |
Citations for Anti FNDC3B pAb (ATL-HPA007859) – 4 Found |
Bian, Tingting; Zheng, Liangfeng; Jiang, Daishan; Liu, Jian; Zhang, Jianguo; Feng, Jia; Zhang, Qing; Qian, Li; Qiu, Hongmei; Liu, Yifei; Yao, Sumei. Overexpression of fibronectin type III domain containing 3B is correlated with epithelial-mesenchymal transition and predicts poor prognosis in lung adenocarcinoma. Experimental And Therapeutic Medicine. 2019;17(5):3317-3326. PubMed |
Wei, Jinwang; Sheng, Yuanyuan; Li, Jianhua; Gao, Xiaomei; Ren, Ning; Dong, Qiongzhu; Qin, Lunxiu. Genome-Wide Association Study Identifies a Genetic Prediction Model for Postoperative Survival in Patients with Hepatocellular Carcinoma. Medical Science Monitor : International Medical Journal Of Experimental And Clinical Research. 2019;25( 30945699):2452-2478. PubMed |
Han, Bing; Wang, Hongbo; Zhang, Jianzhao; Tian, Jingwei. FNDC3B is associated with ER stress and poor prognosis in cervical cancer. Oncology Letters. 2020;19(1):406-414. PubMed |
Wang, Haiyan; Guo, Longlong; Wang, Yang; Song, Shan. Isoflurane upregulates microRNA-9-3p to protect rats from hepatic ischemia-reperfusion injury through inhibiting fibronectin type III domain containing 3B. Cell Cycle (Georgetown, Tex.). 2021;20(16):1527-1539. PubMed |