Anti FNDC1 pAb (ATL-HPA030963)

Atlas Antibodies

SKU: ATL-HPA030963-25

• 
• 

Protein Description: fibronectin type III domain containing 1
Gene Name: FNDC1
Alternative Gene Name: bA243O10.1, dJ322A24.1, FNDC2, KIAA1866
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071984: 81%, ENSRNOG00000030210: 78%
Entrez Gene ID: 84624
Uniprot ID: Q4ZHG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ECYAEEDEFSGLETDTAVPTEEAYVIYDEDYEFETSRPPTTTEPSTTATTPRVIPEEGAISSFPEEEFDLAGRKRFVAPYVTYLNKDPSAPCSLTDALD
• Gene Sequence: ECYAEEDEFSGLETDTAVPTEEAYVIYDEDYEFETSRPPTTTEPSTTATTPRVIPEEGAISSFPEEEFDLAGRKRFVAPYVTYLNKDPSAPCSLTDALD
• Gene ID - Mouse: ENSMUSG00000071984
• Gene ID - Rat: ENSRNOG00000030210
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FNDC1 pAb (ATL-HPA030963) – 1 Found

Jiang, Tao; Gao, Wenyu; Lin, Shengjie; Chen, Hao; Du, Bin; Liu, Qing; Lin, Xiaoyan; Chen, Qiang. FNDC1 Promotes the Invasiveness of Gastric Cancer via Wnt/β-Catenin Signaling Pathway and Correlates With Peritoneal Metastasis and Prognosis. Frontiers In Oncology. 10( 33392086):590492.