Anti FMR1NB pAb (ATL-HPA011284 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA011284-25

• 
• 

Protein Description: fragile X mental retardation 1 neighbor
Gene Name: FMR1NB
Alternative Gene Name: CT37, FLJ25736, NY-SAR-35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062170: 42%, ENSRNOG00000053397: 45%
Entrez Gene ID: 158521
Uniprot ID: Q8N0W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQM
• Gene Sequence: VLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQM
• Gene ID - Mouse: ENSMUSG00000062170
• Gene ID - Rat: ENSRNOG00000053397
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FMR1NB pAb (ATL-HPA011284 w/enhanced validation) – 2 Found

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. 

Flores-Villanueva, Pedro O; Ganachari, Malathesha; Guio, Heinner; Mejia, Jaime A; Granados, Julio. An Isolated TCR αβ Restricted by HLA-A*02:01/CT37 Peptide Redirecting CD8(+) T Cells To Kill and Secrete IFN-γ in Response to Lung Adenocarcinoma Cell Lines. Journal Of Immunology (Baltimore, Md. : 1950). 2018;200(8):2965-2977.