Anti FMNL3 pAb (ATL-HPA023201)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023201-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FMNL3
Alternative Gene Name: DKFZp762B245, MGC45819, WBP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023008: 91%, ENSRNOG00000056297: 90%
Entrez Gene ID: 91010
Uniprot ID: Q8IVF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCP |
| Gene Sequence | LDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCP |
| Gene ID - Mouse | ENSMUSG00000023008 |
| Gene ID - Rat | ENSRNOG00000056297 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FMNL3 pAb (ATL-HPA023201) | |
| Datasheet | Anti FMNL3 pAb (ATL-HPA023201) Datasheet (External Link) |
| Vendor Page | Anti FMNL3 pAb (ATL-HPA023201) at Atlas Antibodies |
| Documents & Links for Anti FMNL3 pAb (ATL-HPA023201) | |
| Datasheet | Anti FMNL3 pAb (ATL-HPA023201) Datasheet (External Link) |
| Vendor Page | Anti FMNL3 pAb (ATL-HPA023201) |
| Citations for Anti FMNL3 pAb (ATL-HPA023201) – 1 Found |
| Wu, Yanxia; Shen, Zhihua; Wang, Keke; Ha, Yanping; Lei, Hong; Jia, Yanan; Ding, Ranran; Wu, Dongmei; Gan, Siyuan; Li, Rujia; Luo, Botao; Jiang, Hanguo; Jie, Wei. High FMNL3 expression promotes nasopharyngeal carcinoma cell metastasis: role in TGF-β1-induced epithelia-to-mesenchymal transition. Scientific Reports. 2017;7( 28198387):42507. PubMed |