Anti FMNL3 pAb (ATL-HPA023201)

Atlas Antibodies

SKU:
ATL-HPA023201-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: formin-like 3
Gene Name: FMNL3
Alternative Gene Name: DKFZp762B245, MGC45819, WBP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023008: 91%, ENSRNOG00000056297: 90%
Entrez Gene ID: 91010
Uniprot ID: Q8IVF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCP
Gene Sequence LDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCP
Gene ID - Mouse ENSMUSG00000023008
Gene ID - Rat ENSRNOG00000056297
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FMNL3 pAb (ATL-HPA023201)
Datasheet Anti FMNL3 pAb (ATL-HPA023201) Datasheet (External Link)
Vendor Page Anti FMNL3 pAb (ATL-HPA023201) at Atlas Antibodies

Documents & Links for Anti FMNL3 pAb (ATL-HPA023201)
Datasheet Anti FMNL3 pAb (ATL-HPA023201) Datasheet (External Link)
Vendor Page Anti FMNL3 pAb (ATL-HPA023201)



Citations for Anti FMNL3 pAb (ATL-HPA023201) – 1 Found
Wu, Yanxia; Shen, Zhihua; Wang, Keke; Ha, Yanping; Lei, Hong; Jia, Yanan; Ding, Ranran; Wu, Dongmei; Gan, Siyuan; Li, Rujia; Luo, Botao; Jiang, Hanguo; Jie, Wei. High FMNL3 expression promotes nasopharyngeal carcinoma cell metastasis: role in TGF-β1-induced epithelia-to-mesenchymal transition. Scientific Reports. 2017;7( 28198387):42507.  PubMed