Anti FMNL3 pAb (ATL-HPA002552)

Atlas Antibodies

Catalog No.: ATL-HPA002552-25

Protein Description: formin-like 3
Gene Name: FMNL3
Alternative Gene Name: DKFZp762B245, MGC45819, WBP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023008: 100%, ENSRNOG00000056297: 100%
Entrez Gene ID: 91010
Uniprot ID: Q8IVF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQE
• Gene Sequence: LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQE
• Gene ID - Mouse: ENSMUSG00000023008
• Gene ID - Rat: ENSRNOG00000056297
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.