Anti FMNL3 pAb (ATL-HPA002552)

Atlas Antibodies

SKU:
ATL-HPA002552-25
  • Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells of tubules.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol, the Golgi apparatus & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: formin-like 3
Gene Name: FMNL3
Alternative Gene Name: DKFZp762B245, MGC45819, WBP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023008: 100%, ENSRNOG00000056297: 100%
Entrez Gene ID: 91010
Uniprot ID: Q8IVF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQE
Gene Sequence LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQE
Gene ID - Mouse ENSMUSG00000023008
Gene ID - Rat ENSRNOG00000056297
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FMNL3 pAb (ATL-HPA002552)
Datasheet Anti FMNL3 pAb (ATL-HPA002552) Datasheet (External Link)
Vendor Page Anti FMNL3 pAb (ATL-HPA002552) at Atlas Antibodies

Documents & Links for Anti FMNL3 pAb (ATL-HPA002552)
Datasheet Anti FMNL3 pAb (ATL-HPA002552) Datasheet (External Link)
Vendor Page Anti FMNL3 pAb (ATL-HPA002552)