Anti FMNL1 pAb (ATL-HPA008129 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA008129-25
  • Immunohistochemistry analysis in human lymph node and liver tissues using HPA008129 antibody. Corresponding FMNL1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Western blot analysis in human cell lines U-251MG and PC-3 using Anti-FMNL1 antibody. Corresponding FMNL1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: formin-like 1
Gene Name: FMNL1
Alternative Gene Name: C17orf1, C17orf1B, FMNL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055805: 96%, ENSRNOG00000003207: 96%
Entrez Gene ID: 752
Uniprot ID: O95466
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFS
Gene Sequence LHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFS
Gene ID - Mouse ENSMUSG00000055805
Gene ID - Rat ENSRNOG00000003207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FMNL1 pAb (ATL-HPA008129 w/enhanced validation)
Datasheet Anti FMNL1 pAb (ATL-HPA008129 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FMNL1 pAb (ATL-HPA008129 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FMNL1 pAb (ATL-HPA008129 w/enhanced validation)
Datasheet Anti FMNL1 pAb (ATL-HPA008129 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FMNL1 pAb (ATL-HPA008129 w/enhanced validation)



Citations for Anti FMNL1 pAb (ATL-HPA008129 w/enhanced validation) – 4 Found
Pfisterer, Simon G; Gateva, Gergana; Horvath, Peter; Pirhonen, Juho; Salo, Veijo T; Karhinen, Leena; Varjosalo, Markku; Ryhänen, Samppa J; Lappalainen, Pekka; Ikonen, Elina. Role for formin-like 1-dependent acto-myosin assembly in lipid droplet dynamics and lipid storage. Nature Communications. 2017;8( 28361956):14858.  PubMed
Gardberg, Maria; Heuser, Vanina D; Iljin, Kristiina; Kampf, Caroline; Uhlen, Mathias; Carpén, Olli. Characterization of Leukocyte Formin FMNL1 Expression in Human Tissues. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2014;62(6):460-470.  PubMed
Miller, Matthew R; Blystone, Scott D. Reliable and inexpensive expression of large, tagged, exogenous proteins in murine bone marrow-derived macrophages using a second generation lentiviral system. Journal Of Biological Methods. 2(3):e23.  PubMed
Higa, Nayuta; Shinsato, Yoshinari; Kamil, Muhammad; Hirano, Takuro; Takajo, Tomoko; Shimokawa, Michiko; Minami, Kentaro; Yamamoto, Masatatsu; Kawahara, Kohichi; Yonezawa, Hajime; Hirano, Hirofumi; Furukawa, Tatsuhiko; Yoshimoto, Koji; Arita, Kazunori. Formin-like 1 (FMNL1) Is Associated with Glioblastoma Multiforme Mesenchymal Subtype and Independently Predicts Poor Prognosis. International Journal Of Molecular Sciences. 2019;20(24)  PubMed