Anti FMN1 pAb (ATL-HPA046786)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046786-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $303.00
    
         
                            Gene Name: FMN1
Alternative Gene Name: DKFZP686C2281, FLJ45135, FMN, LD, MGC125288, MGC125289
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044042: 90%, ENSRNOG00000031760: 92%
Entrez Gene ID: 342184
Uniprot ID: Q68DA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Gene Sequence | PLPEPQDFFLASQVKFEDLIKDLRKLKRQLEASEKQMVVVCKESPKEYLQPFKDKLEEFFQ | 
| Gene ID - Mouse | ENSMUSG00000044042 | 
| Gene ID - Rat | ENSMUSG00000044042 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti FMN1 pAb (ATL-HPA046786) | |
| Datasheet | Anti FMN1 pAb (ATL-HPA046786) Datasheet (External Link) | 
| Vendor Page | Anti FMN1 pAb (ATL-HPA046786) at Atlas Antibodies | 
| Documents & Links for Anti FMN1 pAb (ATL-HPA046786) | |
| Datasheet | Anti FMN1 pAb (ATL-HPA046786) Datasheet (External Link) | 
| Vendor Page | Anti FMN1 pAb (ATL-HPA046786) | 
 
         
                             
                                        